Print…

You Searched For: Methyl+Indole-2-carboxylate


9,520  results were found

Refine Results Sort by
SearchResultCount:"9520"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103009-388

Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-TCB4605-1G

3-Bromo-2-thenoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-Bromothiophene-2-carboxylic Acid, Purity: >98.0%(GC)(T), Cas no. 7311-64-0, Molecular formula: C5H3BrO2S, Form: Crystal- Powder, Colour: White - Very pale yellow, Size: 5G

SDS

Image Unavailable-TCB4249-5G

tert-Butyl-3-(hydroxymethyl)pyrrolidine-1-carboxylate ≥95.0% (by GC)

Supplier: TCI America
Description: CAS Number: 114214-69-6
MDL Number: MFCD02179040
Molecular Formula: C10H19NO3
Molecular Weight: 201.27
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 291
Specific Gravity (20/20): 1.06

SDS

Image Unavailable-TCP1830-5G

(R)-Piperidine-2-carboxylic acid ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 1723-00-8
MDL Number: MFCD00064346
Molecular Formula: C6H11NO2
Molecular Weight: 129.16
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 270
Specific rotation [a]20/D: 27 deg (C=1, H2O)

SDS Certificates

Image Unavailable-TCE0855-1G

Ethyl-1-benzyl-3-oxopiperidine-4-carboxylate hydrochloride ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 52763-21-0
MDL Number: MFCD00012792
Molecular Formula: C15H19NO3
Molecular Weight: 297.78
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 165

SDS

Product Image-10072-294

Human Recombinant Esd (from E. coli)

Catalog Number: (10072-294)
Supplier: Prosci
Description: A carboxylic ester + H2O = an alcohol + a carboxylic anion. Homodimer. Cytoplasmic vesicles. There are two major electrophoretic isotypes. The sequence of the ESD*1 variant is shown. Similar to yeast HRE299.
Image Unavailable-TCB4625-25G

1-Boc-piperidine ≥98.0% (by GC)

Supplier: TCI America
Description: 1-(tert-Butoxycarbonyl)piperidine, Purity: >98.0%(GC), Cas no. 75844-69-8, Molecular formula: C10H19NO2, Form: Clear- Slightly cloudy, Colour: Colorless - Almost colorless, Synonyms: 1-Boc-piperidine, tert-Butyl Piperidine-1-carboxylate, Size: 5G

SDS Certificates

Image Unavailable-TCC2680-1G

1-(Benzyloxycarbonylamino)cyclopropyl-1-carboxylic acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 84677-06-5
MDL Number: MFCD00083285
Molecular Formula: C12H13NO4
Molecular Weight: 235.24
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 159
Storage Temperature: 0-10°C

SDS

Image Unavailable-TCH1471-1G

5-Hydroxypicolinic acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: 5-Hydroxypyridine-2-carboxylic Acid, Purity: >98.0%(HPLC)(T), CAS No: 15069-92-8, Molecular Formula: C6H5NO3, Molecular Weight: 139.11, Synonym: 5-Hydroxypicolinic Acid, Physical state: Solid, Form: Crystal - Powder, Colour: White - Very pale yellow, Size: 5G

SDS

Image Unavailable-TCC2897-5G

7-Chloro-1-ethyl-6-fluoro-4-oxo-1,4-dihydro-3-quinolinecarboxylic acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxoquinoline-3-carboxylic Acid, CAS Number: 68077-26-9, Purity: 98.0%, Molecular Formula: C12H9ClFNO3, Molecular Weight: 269.66 g/mol, Physical Form: Solid, Size: 1G

SDS Certificates

Image Unavailable-AAH34258-03

3-Chloro-5-(trifluoromethyl)picolinic acid 97%

Catalog Number: (AAH34258-03)
Supplier: Thermo Scientific Chemicals
Description: 3-Chloro-5-(trifluoromethyl)pyridine-2-carboxylic acid, Purity: 97%, Cas Number: 80194-68-9, Molecular Formula: C7H3ClF3NO2, Color: White to cream, Form: Solid, Synonyms: 3-Chloro-5-(trifluoromethyl)picolinic acid, Size: 1g

SDS Certificates


Image Unavailable-C-2555.0005BA

Z-Pyr-OH

Supplier: Bachem Americas
Description: Sequence: Z-Pyr-OH

Image Unavailable-B-1925.0001BA

Fmoc-D-Tic-OH

Supplier: Bachem Americas
Description: Sequence: Fmoc-D-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid

Image Unavailable-TCB3892-5G

tert-Butyl-4-carbamoylpiperidine-1-carboxylate ≥97.0% (by GC, total nitrogen)

Supplier: TCI America
Description: CAS Number: 91419-48-6
MDL Number: MFCD02180953
Molecular Formula: C11H20N2O3
Molecular Weight: 228.29
Purity/Analysis Method: >97.0% (GC,N)
Form: Crystal
Melting point (°C): 166

SDS

Product Image-BDH1139-4LG

tert-Butyl methyl ether ≥99% ACS, VWR Chemicals BDH®

Catalog Number: (BDH1139-4LG)
Supplier: VWR International
Description: Meets ACS specifications for general use.

SDS Certificates


Product Image-10064-746

D(-)-Luciferin sodium salt, Ultra Pure Grade

Catalog Number: (10064-746)
Supplier: VWR
Description: D(-)-Luciferin sodium salt, Ultra Pure Grade

SDS Certificates


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,169 - 1,184 of 9,520
no targeter for Bottom