You Searched For: Anaspec Inc

Supplier: Anaspec Inc

Description: This is a pyroglutamic acid modified beta-amyloid 11-42 peptide. Pyroglutamic acid modified isoforms form the major isoforms with up to 20% of the total beta-amyloid species.
Sequence: Pyr-VHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3317.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-238)

Supplier: Anaspec Inc

Description: This is the pro-apoptotic peptide composed of D-amino acids, 5-FAM labeled. This alpha-helical amphipathic peptide is toxic to eukaryotic cells if internalized by a suitable targeting mechanism. It disrupts mitochondrial membranes upon receptor-mediated cell internalization and causes programmed cell death.
Sequence:5-FAM-klaklakklaklak-NH2
MW:1881.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-188)

Supplier: Anaspec Inc

Description: This peptide is histone H3 (21-43) acetylated at Lys23 with a C-terminal GG linker followed by a biotinylated Lys. Acetylation of histone H3 occurs at Lys14 or Lys23 without preference. Lysine acetylation in histone H3 is associated with transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:AT-K(Ac)-AARKSAPATGGVKKPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-384)

Supplier: Anaspec Inc

Description: The benzothiazole dye thioflavin T (ThT) is a classic amyloid stain for senile plaques containing bA4 peptide in Alzheimer's disease brain.

Catalog Number: (103011-138)

Supplier: Anaspec Inc

Description: A fluorescent photoaffinity label that couples covalently to nucleic acids upon light irradiation

Catalog Number: (103008-602)

Supplier: Anaspec Inc

Description: This is a substrate peptide for Interleukin-1 Receptor-Associated Kinase (IRAK) 4, derived from the IRAK-1 activation loop peptide amino acids 360 to 380. This peptide sequence contains Ser-376, one of the primary phospho-acceptor residues of IRAK-1. IRAK-4 phosphorylates IRAK-1 as a key step in regulation of inflammatory signaling pathways.
Sequence:KKARFSRFAGSSPSQSSMVAR
MW:2285.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-242)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-1, 2, 8, 9, 12, 13 and 14 activities, Abs/Em = 494/521 nm.
Sequence:QXL™ 520-PLGC(Me)HAr-K(5-FAM)-NH2
MW:1743.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-646)

Supplier: Anaspec Inc

Description: This peptide is a fusion of A208, derived from murine laminin a1, and the active site of fibronectin (GRGDS), with a glycine spacer. This peptide forms amyloid-like fibrils and promotes formation of actin stress fibers that mediate fibroblast cell attachment, offering it potential as a bioadhesive for tissue regeneration and engineering. FN-A208 interacts with IKVAV receptors and integrins. Its activity is disrupted by the presence of EDTA.
Sequence:GRGDSGAASIKVAVSADR
MW:1716.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-346)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1-21. It is monomethylated at lysine 9 with a C-terminal GG linker followed by a biotinylated lysine. The monomethylation of histone H3 at lysine 9 is dynamically and sex-differentially regulated during meiotic prophase. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin)-NH2
MW:2736.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-042)

Supplier: Anaspec Inc

Description: This peptide is histone H3 with acetylation at Lys4. It is biotinylated through a C-terminal GGK linker. This post-translationally modified histone peptide is found in humans, Tetrahymena thermophila, Schizosaccharomyces pombe , and mice. Acetylation at Lys4 is controlled by Mst1. This peptide acts as a chromodomain switch by weakening the interaction between Chp1 and the H3K9 methylated tail, thus facilitating binding of HP1 proteins. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ART-K(Ac)-QTARKSTGGKAPRKQLA-GGK(biotin)
MW:2765.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-554)

Supplier: Anaspec Inc

Description: This peptide is a fragment of the JAG-1 protein. JAG-1 is Notch ligand, a peptide that is the most conspicuously expressed ligand in skin. JAG-1 induces epidermal maturation. Exposing submerged keratinocytes monolayers to JAG-1 with elevated calcium concentration produces stratification with loricrin expression and NF-κB activation.
Sequence: CDDYYYGFGCNKFCRPR
MW: 2107.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103007-166)

Supplier: Anaspec Inc

Description: This peptide is amino acids 48 to 57 fragment of TAT with an additional cysteine residue at the N-terminus. This peptide contains the protein transduction domain (PTD) of the HIV Tat protein that inhibits HSV-1 entry. The addition of a cysteine residue to the N-terminus of the Tat-PTD (Tat-C peptide) improves the antiviral activity against HSV-1 and HSV-2. Tat-C acts extracellularly, blocking entry of adsorbed virus immediately without eluting virions.
Sequence: CGRKKRRQRRR
MW: 1499.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103010-192)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 647 acid, SE is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy5 dyes, resulting in an optimal match to filters designed for Cy5 dyes.

Catalog Number: (102996-764)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a generic fluorogenic substrate for assaying MMPs. Abs/Em = 325/393 nm.
Sequence:Mca-PLGL-Dap(Dnp)-AR
MW:1094.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102998-422)

Supplier: Anaspec Inc

Description: This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4541.1 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Neuropeptide ACTH (adenocorticotropin) amino acids (1-39), Cat AS-20610, is the natural cleavage product from POMC (proopimelanocortin) processing; however, the first 24-amino acid sequence from the carboxyl end, ACTH (1-24) has full biological activity of the (1-39) peptide. Both ACTH (1-24) and (1-39) possess neurotropic activity.
Sequence: SYSMEHFRWGKPVGKKRRPVKVYP
MW: 2933.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C