Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103010-236

SensoLyte* 520 MMP-7 Assay Kit

Description: SensoLyte* 520 MMP-7 Assay Kit *Fluorimetric*, Components: MMP-7 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability
Catalog Number: 103010-236
Supplier: Anaspec Inc
Image Unavailable-103008-178

[Lys(Ac)9]-Histone H3 (1-24) H3K9(Ac) 1mg

Description: [Lys(Ac)9]-Histone H3 (1-24), H3K9(Ac), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2597, Sequence: ARTKQTAR-K(Ac)-STGGKAPRKQLATKA, Histone 3 peptide is acetylated at lysine residue at 9th position, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-178
Supplier: Anaspec Inc
Image Unavailable-103009-906

[Arg(Me2s)8]-Histone H3 (1-21)

Description: [Arg(Me2s)8]-Histone H3 (1-21), Purity: HPLC >/= 95%, MW: 2637.1, Sequence: [ARTKQTA-R(Me2s)-KSTGGKAPRKQLA-K(Biotin)] dimethylated at Arg8 with a methyl group added, to each nitrogen of the guanidinium group. Biotin - labeled, Store: -20 deg C, Size: 1mg
Catalog Number: 103009-906
Supplier: Anaspec Inc
Image Unavailable-103007-608

[Asn7]-beta-Amyloid (1-42) Tottori-Japanese Mutation 0.5 mg

Description: [Asn7]-beta-Amyloid (1-42), Tottori-Japanese Mutation, Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, Asp7 is replaced by Asn7, Molecular Weight: 4513.1, Apperance: Powder, Size: 0.5 mg
Catalog Number: 103007-608
Supplier: Anaspec Inc
Image Unavailable-103010-288

SensoLyte* Plus 520 MMP-1 Assay Kit

Description: SensoLyte* Plus 520 MMP-1 Assay Kit *Fluorimetric*, Components: MMP-1 antibody 12 X 8 black strips, MMP-1 STD 10 u
g/mL, 10 ul, MMP dilution buffer 10 mL, 10 X Wash buffer 50 mL, APMA 100 mM, 150 ul, MMP-1 substrate 50 ul, Assay buffer 50 mL, Stop Solution 10 mL
Catalog Number: 103010-288
Supplier: Anaspec Inc
Image Unavailable-103006-536

[Lys(Ac)8] - Histone H4 (1 - 21) - GGK(Biotin) H4K8(Ac) biotin - labeled 1mg

Description: [Lys(Ac)8] - Histone H4 (1-21) - GGK(Biotin), H4K8(Ac), biotin - labeled, Purity: HPLC >/= 95%, Sequence (One-Letter Code): Ac-SGRGKGG-K(Ac)-GLGKGGAKRHRKV-GGK(Biotin), Molecular weight: 2644.1, Storage: -20deg C, Size: 1mg
Catalog Number: 103006-536
Supplier: Anaspec Inc
Image Unavailable-103008-316

Histone H2A (1-22)-GK(Biotin) 1mg

Description: Histone H2A (1-22)-GK(Biotin), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2612, Sequence: SGRGKQGGKARAKAKSRSSRA-GGK(Biotin)-NH2, peptide is Histone H2A amino acid residues 1 to 22 with a C-terminal Gly, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-316
Supplier: Anaspec Inc
Image Unavailable-102996-382

Biotin-PACAP (1-38) 0.5 mg

Description: Biotin-PACAP (1-38), amide, human, ovine, rat, Purity: HPLC >/= 95%, Molecular Weight: 4761.6, Sequence: Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2, Appearance: Solid, Storage: -20 deg C, Size: 0.5 mg
Catalog Number: 102996-382
Supplier: Anaspec Inc
Image Unavailable-103008-276

[Lys(Me2)36]-Histone H3 (26-46) H3K36(Me2) 1mg

Description: [Lys(Me2)36]-Histone H3 (26-46), H3K36(Me2), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2630.1, Sequence: RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(BIOTIN), dimethylated at lysine-36, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-276
Supplier: Anaspec Inc
Image Unavailable-103005-904

DNA - PK Substrate 5 mg

Description: DNA - PK Substrate, Purity: % Peak Area By HPLC >/= 95%, Molecular Weight: 1759, One-Letter Code: EPPLSQEAFADLWKK, Three-Letter Code: H - Glu - Pro - Pro - Leu - Ser - Gln - Glu - Ala - Phe - Ala - Asp - Leu - Trp - Lys - Lys - OH, Physical State: Pink powder, Size: 5 mg
Catalog Number: 103005-904
Supplier: Anaspec Inc
Image Unavailable-103007-256

Beta - Amyloid (1 - 40) - Cys 0.1 mg

Description: Beta - Amyloid (1 - 40) - Cys, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC, synthetic peptide corresponds to B--Amyloid (1-40) with an additional cysteine at the C-terminus, Molecular Weight: 4433, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-256
Supplier: Anaspec Inc
Image Unavailable-102998-068

5 - FITC Fluorescein isothiocyanate 1 g

Description: 5 - FITC Fluorescein isothiocyanate, Molecular Weight 389.38, Molecular Formula C21H11NO5S, Spectral Properties Abs/Em = 494/519 nm, Solvent System DMSO, Physical State Solid, Slightly water soluble, Storage -20 deg C, Size: 1g
Catalog Number: 102998-068
Supplier: Anaspec Inc
Image Unavailable-103001-242

Anti-Human MOG (1-125) Human IgG Specific ELISA Kit

Description: SensoLyte* Anti-Human MOG (1-125) Human IgG Specific ELISA Kit, Optimized to detect anti-human MOG (1-125) IgG in human samples, Wells are pre-coated with recombinant human MOG, Storage: At 2-8 degree C, Size: One 96-well strip plate
Catalog Number: 103001-242
Supplier: Anaspec Inc
Image Unavailable-103007-980

[Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me3) 0.25 mg

Description: [Lys(Me3)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me3), biotin-labeled, Sequence: ARTKQTAR-K(Me3)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, residues 1 to 21 tri-methylated at Lys-9, Molecular Weight: 2765.2, Size: 0.25 mg
Catalog Number: 103007-980
Supplier: Anaspec Inc
Image Unavailable-103010-878

HiLyte* Fluor 488 amine, TFA Salt 1 mg

Description: HiLyte* Fluor 488 amine, TFA Salt, carbonyl-reactive fluorescent labeling dye, independent of pH from 4 to 10, Molecular Weight: 530.45, Spectral Properties: Abs/Em = 503/528 nm, Solvent System: DMF or DMSO, Physical State: Solid, Storage: -20 deg C, Size: 1mg
Catalog Number: 103010-878
Supplier: Anaspec Inc
Image Unavailable-103010-838

5 - TAMRA, Special Formulation 1 g

Description: 5 - TAMRA, Special Formulation, purified single isomer, Synonym: 5-Carboxytetramethylrhodamine, Molecular Weight: 430.45 (Free Acid), Spectral Properties: Abs/Em = 541/568 nm, Solvent System: DMF or DMSO, Appearance: Dark red solid, Storage -20 deg C, Size: 1 g
Catalog Number: 103010-838
Supplier: Anaspec Inc
1 - 16 of 1,262