Print…

You Searched For: Anaspec Inc


1,874  results were found

Refine Results Sort by
SearchResultCount:"1874"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103009-616

[Lys(Me3)20]-Histone H4 (8-30)- WGK,Biotin

Catalog Number: (103009-616)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is tri-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me3)-VLRDNIQGITWG-K(biotin)
MW:3184.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-940

Human LL17-29

Catalog Number: (103009-940)
Supplier: Anaspec Inc
Description: This peptide is an active segment of LL-37, a peptide derived from the C-terminal domain of human cathelicidin antimicrobial peptide. It has been reported that the LL17-32 peptide exhibits reversal effect on ABCG2-mediated multidrug resistance in cancer cell lines.
Sequence:FKRIVQRIKDFLRNLV
MW:2045.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-986

Bovine P2 (53-78)

Catalog Number: (103009-986)
Supplier: Anaspec Inc
Description: This peptide is derived from bovine peripheral myelin P2 protein amino acid residues 53-78. It is neuritogenic, inducing experimental autoimmune neuritis (EAN) in Lewis rats.
Sequence:TESPFKNTEISFKLGQEFEETTADNR
MW:3019.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-100

Human [NMeG24, NMeI26] Islet Amyloid Polypeptide (22-27)

Catalog Number: (103007-100)
Supplier: Anaspec Inc
Description: This amino acids 22 to 27 fragment is a modification of the human islet amyloid polypeptide hIAPP (NFGAIL) with N-methylation of the amide bonds at G24 and I26. The introduction of two N-methyl rests in the amyloid-core-containing sequence NFGAIL converts this amyloidogenic and cytotoxic sequence into non-amyloidogenic and non-cytotoxic peptide. The peptide is able to bind with high-affinity full-length hIAPP and to inhibit its fibrillogenesis.
Sequence: NF-(NMe-G)-A-(NMe-I)-L
Molecular Weight: 661.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-256

Human Beta-Amyloid (1-40)

Catalog Number: (103007-256)
Supplier: Anaspec Inc
Description: This synthetic peptide corresponds to ß--Amyloid (1-40) with an additional cysteine at the C-terminus.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVC
Molecular Weight: 4433 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-246

HIV TAT-NSF222scr Fusion Polypeptide

Catalog Number: (103007-246)
Supplier: Anaspec Inc
Description: This is a scrambled TAT-NSF222scr fusion polypeptide. It is composed of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide, 3 glycines as a linker, followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. This peptide is used as a control for the TAT-NSF222 peptide.
Sequence: YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
MW: 4214.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-252

Bacterial Sortase Substrate II, DABCYL-EDANS

Catalog Number: (103007-252)
Supplier: Anaspec Inc
Description: This peptide is a C-terminal surface sorting signal with a conserved LPXTG motif, labeled with the Dabcyl/Edans FRET pair. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Surface proteins of Staphylococcus aureus are anchored to the bacterial cell wall by a mechanism requiring this C-terminal sorting signal. Cell wall sorting is the covalent attachment of surface proteins to the peptidoglycan via a C-terminal sorting signal that contains a consensus LPXTG sequence. Cleavage of this FRET substrate by sortase reveals the fluorescent signal that may be measured to study sortase activity. Inhibition of the sortase activity is a potential way of treatment of the staphylococcal infection. The LPXTG motif is conserved in more than 100 surface proteins of Gram-positive pathogens.
Sequence:Dabcyl-QALPETGEE-Edans
MW:1472.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-408

Human gp100 (25–33) peptide

Catalog Number: (103007-408)
Supplier: Anaspec Inc
Description: This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific, H-2Db-restricted, CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
MW: 1155.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-390

Lymphocytic Choreomeningitis Virus (LCMV) 276-286

Catalog Number: (103007-390)
Supplier: Anaspec Inc
Description: This peptide is amino acids 276 to 286 fragment of the lymphocytic choriomeningitis virus (LCMV) glycoprotein (GP), also known as GP276. It is the H-2Db restricted epitope. LCMV has been routinely exploited for the study of adaptive immune responses to viral infection. Fifty to seventy percent of CD8 T cells at the peak of LCMV infection appear to be specific for five LCMV-derived epitopes including GP276.
Sequence:SGVENPGGYCL
MW:1095.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-226

[Lys(Me1)79]-Histone H3 (69-89)-K,Biotin

Catalog Number: (103008-226)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 with amino acid residues 69 to 89 mono-methylated at Lys-79 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:RLVREIAQDF-K(Me1)-TDLRFQSSAV-K(Biotin)
MW:2848.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-276

[Lys(Me2)36]-Histone H3 (26-46)

Catalog Number: (103008-276)
Supplier: Anaspec Inc
Description: This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-312

[Lys(Ac)18]-Histone 3 (1-21)-GGK,Biotin

Catalog Number: (103008-312)
Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 1-21. It is acetylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine 18 is used to predict prostrate cancer recurrence and clinical outcome of patients with both lung and kidney cancer. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Ac)-QLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-316

Histone H2A (1-22)-GK, Biotin

Catalog Number: (103008-316)
Supplier: Anaspec Inc
Description: This peptide is Histone H2A amino acid residues 1 to 22 with a C-terminal Gly followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRGKQGGKARAKAKSRSSRAG-GK(Biotin)-NH2
MW:2612 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-748

Human Beta-Amyloid (11-17)

Catalog Number: (103007-748)
Supplier: Anaspec Inc
Description: This is a short fragment of the b-Amyloid peptide containing Histidine 13 and 14. Alzheimer’s beta amyloid peptides form A? ion channels in lipid bilayers. It is postulated that ion channel activity of A? is related to cytotoxic activity of A?. Small peptides that contain the amino acid sequence of the predicted mouth region of the A? channel pore can inhibit A? ion channel activity. And, Histidines 13 and 14 have been shown to be essential for the peptide to inhibit Alzheimer’s disease A? ion channel and cytotoxicity.
Sequence: EVHHQKL
Molecular Weight: 890 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-103007-788

Rat Angiotensinogen (1-14)

Catalog Number: (103007-788)
Supplier: Anaspec Inc
Description: This peptide is derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate.
Sequence: DRVYIHPFHLLYYS
MW: 1823.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103007-816

Cytomegalovirus (CMV) CMV pp65 Peptide

Catalog Number: (103007-816)
Supplier: Anaspec Inc
Description: This peptide is derived from amino acid residues 13 to 27 of the 65k lower matrix phosphoprotein of the human cytomegalovirus.It contains a nine-amino-acid sequence (LGPISGHVL) that matches the consensus binding motif for a major histocompatibility complex H2-Dd T-cell epitope.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
145 - 160 of 1,874
no targeter for Bottom