You Searched For: Terbium+(III)+chloride


70,861  results were found

SearchResultCount:"70861"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: CAS Number: 32857-63-9
MDL Number: MFCD00082593
Molecular Formula: C12H16O2
Molecular Weight: 192.26
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 81
Catalog Number: (CA82022-846)
Supplier: G-Biosciences
Description: Ellman's reagent is a versatile, water-soluble compound for quantifying free sulfhydryl groups in solution. It reacts with a free sulfhydryl group to yield a mixed disulfide and 2-nitro-5-thiobenzoic acid (NTB), a measurable yellow colored product at 412nm.
Ellman's reagent is very useful as a free sulfhydryl assay reagent due to its high specificity for -SH groups at neutral pH, high molar extinction coefficient and short reaction time.


Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: TCI America
Description: CAS Number: 24123-14-6
MDL Number: MFCD00144824
Molecular Formula: C4H10N2O2
Molecular Weight: 118.14
Purity/Analysis Method: >97.0% (T)
Form: Crystal
Melting point (°C): 143
Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00015629
Supplier: TCI America
Description: CAS Number: 124655-09-0
MDL Number: MFCD23098985
Molecular Formula: C13H24O5
Molecular Weight: 260.33
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.06
Specific rotation [a]20/D: -4 deg (C=2, MeOH)
Storage Temperature: 0-10°C

SDS

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00009203 Beilstein Registry No.: 1744677
Supplier: Spectrum Chemicals
Description: Edetate Disodium, Dihydrate, BiotechGrade is used in molecular biology applications to minimize metal ion contamination and prevent enzymatic activity. EDTA disodium dihydrate is routinely used in electrophoresis DNA and protein separation applications to chelate metal ions required for enzymatic activity that could potentially damage DNA and protein structure.

Catalog Number: (TCA1484-005G)
Supplier: TCI America
Description: CAS Number: 10551-58-3
MDL Number: MFCD00003233
Molecular Formula: C8H8O4
Molecular Weight: 168.15
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 122
Melting point (°C): 56
Flash Point (°C): 107
Storage Temperature: <0°C

Supplier: TCI America
Description: CAS Number: 125572-95-4
MDL Number: MFCD00149243
Molecular Formula: C14H22N2O8
Molecular Weight: 346.34
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 216
Supplier: TCI America
Description: [for Biochemical Research]
CAS Number: 6381-92-6
MDL Number: MFCD00150037
Molecular Formula: C10H16N2O8
Molecular Weight: 336.21
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 252
Supplier: TCI America
Description: CAS Number: 1118-68-9
MDL Number: MFCD00004283
Molecular Formula: C4H9NO2
Molecular Weight: 103.12
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 180
Supplier: G-Biosciences
Description: G-Biosciences' EDTA, or ethylenediamine-tetraacetic acid, is available as EDTA disodium salt dihydrate, supplied in four different sizes, as well as a 0.5M EDTA solution.
EDTA Specificity: A metal chelator that inhibits metalloproteases.

SDS

Supplier: LGC Standards
Description: TRC (S)-2-Acetamido-5-ureidopentanoic Acid

New Product

Supplier: Thermo Scientific Chemicals
Description: Creatine (N-amidinosarcosine), anhydrous 98%
Supplier: Thermo Scientific Chemicals
Description: 4-Morpholineacetic acid hydrochloride, 95%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
289 - 304 of 70,861
no targeter for Bottom