Print…

You Searched For: Nickel+Chromium+alloy+(80:20+w%)


69,362  results were found

Refine Results Sort by
SearchResultCount:"69362"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103006-558

Mouse mCRAMP

Catalog Number: (103006-558)
Supplier: Anaspec Inc
Description: This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence:GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
MW:3878.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-75915-448

Anti-CEACAM1 & CEACAM5 Mouse Monoclonal Antibody [clone: C66/1030]

Catalog Number: (75915-448)
Supplier: Biotium
Description: This antibody recognizes proteins of 80-200 kDa, identified as different members of CEA family. CEA is synthesized during development in the fetal gut and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. This MAb does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. CEA is not found in benign glands, stroma, or malignant prostatic cells. Antibody to CEA is useful in detecting early foci of gastric carcinoma and in distinguishing pulmonary adenocarcinomas (60-70% are CEA positive) from pleural mesotheliomas (rarely or weakly CEA positive) . Anti-CEA positivity is seen in adenocarcinomas from the lung, colon, stomach, esophagus, pancreas, gallbadder, urachus, salivary gland, ovary, and endocervix.
Product Image-103304-866

Formvar Carbon Support Film on Slots, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: The formvar coated grids are stabilized with an evaporated carbon film.

Product Image-103305-180

Formvar Carbon Support Film on Thin Bar Hexagonal Grids, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: The formvar coated grids are stabilized with an evaporated carbon film. This type of coating is excellent for specimen support, especially for ultra-thin sections.

Product Image-CABDH89800-216

Chromium, Single Element ICP and ICP/MS Certified Reference Standards, Enhanced Packaging, ARISTAR®, VWR Chemicals BDH®

Supplier: VWR International
Description: Used with ICP-MS, ICP-OES, DCP, GFAA, and AA

Certificates

Image Unavailable-75917-314

Anti-CEACAM1 & CEACAM5 Mouse Monoclonal Antibody [clone: C66/1009]

Supplier: Biotium
Description: This antibody recognizes proteins of 80-200 kDa, identified as different members of CEA family. CEA is synthesized during development in the fetal gut and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. This MAb does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. CEA is not found in benign glands, stroma, or malignant prostatic cells. Antibody to CEA is useful in detecting early foci of gastric carcinoma and in distinguishing pulmonary adenocarcinomas (60-70% are CEA positive) from pleural mesotheliomas (rarely or weakly CEA positive) . Anti-CEA positivity is seen in adenocarcinomas from the lung, colon, stomach, esophagus, pancreas, gallbadder, urachus, salivary gland, ovary, and endocervix.

Product Image-CA77506-888

Hei-PLATE Mix 'n' Heat Ultimate e-Lift Magnetic Hotplate Stirrers

Supplier: Heidolph NA, LLC
Description: The Hei-PLATE Mix 'n' Heat Ultimate magnetic hotplate stirrers are equipped with numerous interfaces for automated laboratory processes and integration with the Hei-PROCESS software solution.

Image Unavailable-75916-748

Anti-CEACAM1 & CEACAM5 Mouse Monoclonal Antibody [clone: C66/1009]

Catalog Number: (75916-748)
Supplier: Biotium
Description: This antibody recognizes proteins of 80-200 kDa, identified as different members of CEA family. CEA is synthesized during development in the fetal gut and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. This MAb does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. CEA is not found in benign glands, stroma, or malignant prostatic cells. Antibody to CEA is useful in detecting early foci of gastric carcinoma and in distinguishing pulmonary adenocarcinomas (60-70% are CEA positive) from pleural mesotheliomas (rarely or weakly CEA positive) . Anti-CEA positivity is seen in adenocarcinomas from the lung, colon, stomach, esophagus, pancreas, gallbadder, urachus, salivary gland, ovary, and endocervix.
Product Image-103303-948

Carbon Film on Gilder Finder Grids, Electron Microscopy Sciences

Supplier: Electron Microscopy Sciences
Description: A thin film of pure carbon is deposited on the shiny side of the grid.

Product Image-10120-332

Men's Button Lab Coats, 80/20 Poly-Cotton

Supplier: VWR International
Description: These classic white lab coats for men include a five-button front and are made with a soft but very durable 80/20 poly/cotton fabric blend material for long-term wear that can stand up to industrial laundering.

Product Image-CAJT4125-06

Polysorbate 80 NF, Multi-Compendial, meets analytical specification of ChP, BP, JP, Ph. Eur., J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Polysorbate 80 (Vegetable) Chp 4L

Certificates

Image Unavailable-75917-322

Anti-CEACAM1 & CEACAM5 Mouse Monoclonal Antibody (Biotin) [clone: C66/1009]

Supplier: Biotium
Description: This antibody recognizes proteins of 80-200 kDa, identified as different members of CEA family. CEA is synthesized during development in the fetal gut and is re-expressed in increased amounts in intestinal carcinomas and several other tumors. This MAb does not react with nonspecific cross-reacting antigen (NCA) and with human polymorphonuclear leucocytes. It shows no reaction with a variety of normal tissues and is suitable for staining of formalin/paraffin tissues. CEA is not found in benign glands, stroma, or malignant prostatic cells. Antibody to CEA is useful in detecting early foci of gastric carcinoma and in distinguishing pulmonary adenocarcinomas (60-70% are CEA positive) from pleural mesotheliomas (rarely or weakly CEA positive) . Anti-CEA positivity is seen in adenocarcinomas from the lung, colon, stomach, esophagus, pancreas, gallbadder, urachus, salivary gland, ovary, and endocervix.

Product Image-10081-922

Anti-ALDH1B1 Rabbit Polyclonal Antibody

Catalog Number: (10081-922)
Supplier: Proteintech
Description: Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.. ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung.
Image Unavailable-10081-924

Anti-ALDH1B1 Rabbit Polyclonal Antibody

Catalog Number: (10081-924)
Supplier: Proteintech
Description: Aldehyde dehydrogenases (ALDHs) belong to a superfamily of NAD(P)+-dependent enzymes, which catalyze the oxidation of endogenous and exogenous aldehydes to their corresponding acids. ALDH1B1 is a mitochondrial ALDH that it is dramatically upregulated in human colonic adenocarcinoma, making it a potential biomarker for human colon cancer.. ALDH1B1 is a homotetramer expressed in various adult and fetal human tissues including liver, testis, kidney, skeletal muscle, heart, placenta, brain and lung. This antibody is specific to ALDH1B1.
Image Unavailable-103006-888

Rat Uroguanylin

Catalog Number: (103006-888)
Supplier: Anaspec Inc
Description: Uroguanylin is a natriuretic peptide, a hormone that regulates sodium excretion by the kidney when excess NaCl is consumed. Uroguanylin and guanylin are related peptides that activate common guanylate cyclase signaling molecules in the intestine and kidney. Uroguanylin was isolated from urine and duodenum but was not detected in extracts from the colon of rats.
Sequence:TDECELCINVACTGC (Disulfide bonds between Cys4-Cys12 and Cys7-Cys15)
MW:1569.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-470301-850

Nickel

Supplier: Shiv Dial Sud & Sons
Description: CAS Number: 7440-02-0
Formula Weight: 58.71
Formula: Ni
Density (g/mL): 8.90
Boiling Point (°C): 2732
Freezing Point (°C): 1452
Shelf Life (months): 36
Storage: Red

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
145 - 160 of 69,362
no targeter for Bottom