You Searched For: Indium+(III)+nitrate+hydrate


52,540  results were found

SearchResultCount:"52540"

Sort Results

List View Easy View

Rate These Search Results

Supplier: TCI America
Description: CAS Number: 100622-34-2
MDL Number: MFCD03425925
Molecular Formula: C14H11BO2
Molecular Weight: 222.05
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 217
Catalog Number: (TCM0670-025G)
Supplier: TCI America
Description: CAS Number: 61751-44-8
MDL Number: MFCD00059749
Molecular Formula: C9H10N2O
Molecular Weight: 162.19
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 226

SDS


Supplier: TCI America
Description: 5-Amino-2,2-difluoro-1,3-benzodioxole, Purity: >98.0%(GC)(T), CAS Number: 1544-85-0, Molecular Formula: C7H5F2NO2, Molecular Weight: 173.12, Synonyms: 2,2-Difluoro-1,3-benzodioxol-5-amine, 3,4-[(Difluoromethylene)dioxy]aniline, Size: 1G

Catalog Number: (ABCA_AB106101-50UG)
Supplier: Abcam
Description: Mouse monoclonal [34-3C] to Red Blood Cells.

New Product


Supplier: Abcam
Description: Rabbit monoclonal [EPR28251-34] to Hepatitis B Virus Core Antigen.

New Product

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Manganese dichloride tetrahydrate. CAS RN 13446-34-9. Formula Weight: 197.91. Crystals, ‘BAKER ANALYZED’* Reagent, 98.0-101.0%. Meets ACS specifications. Packaged in a plastic container. 12kg.
Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: TCI America
Description: CAS Number: 274257-34-0
MDL Number: MFCD03790006
Molecular Formula: C7H7BF3K
Molecular Weight: 198.04
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 226

SDS

Catalog Number: (TCM2404-25G)
Supplier: TCI America
Description: CAS Number: 1205-17-0
MDL Number: MFCD00067053
Molecular Formula: C11H12O3
Molecular Weight: 192.21
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 154
Flash Point (°C): 100
Specific Gravity (20/20): 1.17

Supplier: Abcam
Description: Alexa Fluor® 647 Rabbit monoclonal [EPR26207-34] to TREM1.

New Product

Catalog Number: (TCD0311-025G)
Supplier: TCI America
Description: CAS Number: 2642-63-9
MDL Number: MFCD00000553
Molecular Formula: C8H6Cl2O
Molecular Weight: 189.04
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 121
Melting point (°C): 72
Flash Point (°C): 110

SDS


Supplier: TCI America
Description: 1,1,2,3,3,3-Hexafluoropropyl Methyl Ether, Purity: >98.0%(GC), CAS Number: 382-34-3, Molecular Formula: C4H4F6O, Molecular Weight: 182.07, Physical state: Liquid, Form: Clear, Colour: Colorless - Almost colorless, Size: 5G

SDS

Catalog Number: (TCD1878-100G)
Supplier: TCI America
Description: CAS Number: 1131-62-0
MDL Number: MFCD00008737
Molecular Formula: C10H12O3
Molecular Weight: 180.20
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 161
Melting point (°C): 49
Flash Point (°C): 110

Catalog Number: (TCA1548-001G)
Supplier: TCI America
Description: CAS Number: 144222-34-4
MDL Number: MFCD02093428
Molecular Formula: C21H22N2O2S
Molecular Weight: 366.48
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 130
Specific rotation [a]20/D: -30 deg (C=1, CH3CN)

Supplier: Abcam
Description: Rabbit monoclonal [EPR23470-34] to B7-H6 - BSA and Azide free (Detector).

New Product

Catalog Number: (89044-788)
Supplier: DWK Life Sciences (KIMBLE)
Description: threaded, 34 mm OD

Small Business Enterprise


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,057 - 1,072 of 52,540
no targeter for Bottom