Print…

You Searched For: 2,3-Dimethylphenylboronic+acid


70,142  results were found

Refine Results Sort by
SearchResultCount:"70142"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CA4.80592.9026

Hydrochloric acid 10% (w/v), EMPROVE® EXPERT Ph. Eur., JP, NF, SAFC®

Supplier: EMD MILLIPORE – PCS CA EXCEP
Description: Elemental impurity specifications have been set considering ICH Q3D (Guideline for Elemental Impurities). Class 1-3 elements are not likely to be present above the ICH Q3D option 1 limit, unless specified and indicated.

SDS

Image Unavailable-10389-570

Anti-CYP24A1 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10389-570)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Product Image-10089-388

Anti-CK23 Rabbit Polyclonal Antibody

Catalog Number: (10089-388)
Supplier: Proteintech
Description: Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9–K23, and the hair keratins Ha1–Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1–K8, and the hair keratins, Hb1–Hb6. KRT 23 belongs to type I keratins.
Image Unavailable-75790-008

Human Recombinant MAG (from Cells)

Catalog Number: (75790-008)
Supplier: Prosci
Description: Human Myelin-Associated Glycoprotein,also known as MAG, Siglec-4,is a cell membrane glycoprotein that is a member of the SIGLEC family of proteins.MAG contains 4 Ig-like C2-type domains and 1 Ig-like V-type domain.MAG is believed to be involved in myelination during nerve regeneration. it is a adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells and Preferentially binds to alpha-2,3-linked sialic acid.
Product Image-10062-012

Anti-ZNF821 Rabbit Polyclonal Antibody

Catalog Number: (10062-012)
Supplier: Prosci
Description: The ZNF821 protein contains two C2H2 zinc finger motifs and a score-and-three (23)-amino acid peptide repeat (STPR) domain. The STPR domain of the encoded protein binds to double stranded DNA and may also contain a nuclear localization signal, suggesting that this protein interacts with chromosomal DNA. The exact function of ZNF821, however, remains unknown.
Image Unavailable-75788-760

Human Recombinant IFN alpha 2a (from E. coli)

Catalog Number: (75788-760)
Supplier: Prosci
Description: At least 23 different variants of IFN- alpha are known. The individual proteins have molecular masses between 19-26 kDa and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- alpha subtypes only differ in their sequences by one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxy-terminal end.
Image Unavailable-103006-368

Rat Brain Natriuretic Peptide 45

Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10096-778

Anti-UMPS Rabbit Polyclonal Antibody

Catalog Number: (10096-778)
Supplier: Proteintech
Description: UMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa.
Product Image-10713-800

Toilet Bowl Cleaner, Amrep Misty® Bolex

Catalog Number: (10713-800)
Supplier: Janitorial Supplies
Description: Highly concentrated blend of detergent, inorganic acid, wetting agent and rinse additives dissolves organic encrustations, scale and stains; keeps toilet bowls and urinals bright and clean.
Image Unavailable-10389-566

Anti-CYP24A1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10389-566)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-10389-576

Anti-CYP24A1 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10389-576)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-CAAAA12702-22

4-Hydroxybenzhydrazide 98%

Supplier: Thermo Scientific Chemicals
Description: 4-Hydroxybenzhydrazide 98%

Certificates

Image Unavailable-75791-716

Mouse Recombinant IFN alpha 2 (from E. coli)

Catalog Number: (75791-716)
Supplier: Prosci
Description: At least 23 different variants of Interferon- alpha are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- alpha subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Image Unavailable-TCE1267-50MG

Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate ≥97.0% (by HPLC)

Catalog Number: (TCE1267-50MG)
Supplier: TCI America
Description: Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate, Purity: >97.0%(HPLC), CAS number: 1678540-23-2, MF: C54H63NO2, Molecular Weight: 758.1, Size: 50 MG
Image Unavailable-102999-764

Human Atrial Natriuretic Peptide (1-28),Biotin

Catalog Number: (102999-764)
Supplier: Anaspec Inc
Description: This ANP (1-28) peptide hormone has been biotinylated at the N-terminus and can be used in conjugation experiments. ANP (1-28) constitutes the first 28 amino acids of the ANP synthesized in the heart of different vertebrates. It plays an important role in the regulation of blood pressure and natriuresis/diuresis. Residues Phe8, Arg14 and the C-terminal sequence of ANP are known to bind to human NPR-A (Natriuretic peptide receptor type A).
Sequence:Biotin-SLRRSSCFGGRMDRIGAQSGLGCNSFRY (Disulfide bridge: 7-23)
MW:3308.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10752-084

Anti-ZNF821 Rabbit Polyclonal Antibody

Catalog Number: (10752-084)
Supplier: Prosci
Description: The ZNF821 protein contains two C2H2 zinc finger motifs and a score-and-three (23)-amino acid peptide repeat (STPR) domain. The STPR domain of the encoded protein binds to double stranded DNA and may also contain a nuclear localization signal, suggesting that this protein interacts with chromosomal DNA. The exact function of ZNF821, however, remains unknown.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 70,142
no targeter for Bottom