Print…

You Searched For: 2,3-Dimethylphenylboronic+acid


70,143  results were found

Refine Results Sort by
SearchResultCount:"70143"

Sort Results

List View Easy View

Rate These Search Results

Product Image-75855-170

Super-Size AkroBins, Akro-Mils

Supplier: Akro-Mils
Description: Super-Size AkroBins offer huge storage capacity and the versatility required to make the most of available space.

Image Unavailable-10774-268

Human Recombinant BCMA (from E. coli)

Supplier: Peprotech
Description: BCMA, a member of the TNF receptor superfamily, binds to BAFF and APRIL. BCMA is expressed on mature B-cells and other B-cell lines, and plays an important role in B-cell development, function and regulation. BCMA also has the capability to activate NF-κB and JNK. The human BCMA gene codes for a 184 amino acid type I transmembrane protein, which contains a 54 amino acid extracellular domain, a 23 amino acid transmembrane domain, and a 107 amino acid cytoplasmic domain. Recombinant soluble Human BCMA is a 50 amino acid polypeptide (5.3 kDa) comprising the TNFR homologous region of the BCMA protein.

Image Unavailable-10389-570

Anti-CYP24A1 Rabbit Polyclonal Antibody (Cy5.5®)

Catalog Number: (10389-570)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Image Unavailable-CAAA10306-09

Diethyl (trichloromethyl)phosphonate ≥98%

Supplier: Thermo Scientific Chemicals
Description: Diethyl (trichloromethyl)phosphonate ≥98%

Certificates

Product Image-10788-258

Mouse Recombinant PDGF-BB (from E. coli)

Supplier: FUJIFILM IRVINE SCIENTIFIC, INC
Description: Interleukin 17AF (IL-17AF) is a heterodimer that is composed of the interleukin 17A (IL-17A) and interleukin 17F (IL-17F) members of the IL-17 family of cytokines. IL-17AF is produced by T helper 17 cells (Th17) following interleukin 23 (IL-23) stimulation.

Image Unavailable-AAJ66616-06

Apramycin sulfate ≥95%

Catalog Number: (AAJ66616-06)
Supplier: Thermo Scientific Chemicals
Description: Apramycin sulfate binds to the deep groove of RNA and effectively inhibits ribosomal translocation prohibiting protein synthesis.

SDS Certificates


Image Unavailable-TCC0553-025G

Choline hydrogen tartrate ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 87-67-2
MDL Number: MFCD00036332
Molecular Formula: C9H19NO7
Molecular Weight: 253.25
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 150
Specific rotation [a]20/D: 17 deg (C=10, H2O)

SDS Certificates

Image Unavailable-TCT1611-25G

(2R)-(-)-2,3-Epoxypropyl toluene-4-sulfonate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 113826-06-5
MDL Number: MFCD00010834
Molecular Formula: C10H12O4S
Molecular Weight: 228.26
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Color: White
Melting point (°C): 48
Flash Point (°C): 202
Specific rotation [a]20/D: -19 deg (C=2.5, CH3CN)

SDS

Image Unavailable-10796-864

Fmoc-Cys(Pam)2-OH(S)

Supplier: Bachem Americas
Description: SPPS employing the pure stereoisomer of Fmoc-Pam₂Cys-OH allows to obtain more homogeneous lipopeptides. The configuration of the bis-palmitoyloxypropyl moiety could influence the biological activity of the peptide conjugate.

Image Unavailable-103006-368

Rat Brain Natriuretic Peptide 45

Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Product Image-10096-778

Anti-UMPS Rabbit Polyclonal Antibody

Catalog Number: (10096-778)
Supplier: Proteintech
Description: UMPS, also named as OPRT and ODC, plays an important role in pyrimidine synthesis, converting orotic acid to uridine 5′ monophosphate. UMPS has four isoforms with MW 53 kDa, 43 kDa, 33 kDa and 23 kDa.
Product Image-10713-800

Toilet Bowl Cleaner, Amrep Misty® Bolex

Catalog Number: (10713-800)
Supplier: Janitorial Supplies
Description: Highly concentrated blend of detergent, inorganic acid, wetting agent and rinse additives dissolves organic encrustations, scale and stains; keeps toilet bowls and urinals bright and clean.
Image Unavailable-TCE1267-50MG

Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate ≥97.0% (by HPLC)

Catalog Number: (TCE1267-50MG)
Supplier: TCI America
Description: Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate, Purity: >97.0%(HPLC), CAS number: 1678540-23-2, MF: C54H63NO2, Molecular Weight: 758.1, Size: 50 MG
Image Unavailable-75791-716

Mouse Recombinant IFN alpha 2 (from E. coli)

Catalog Number: (75791-716)
Supplier: Prosci
Description: At least 23 different variants of Interferon- alpha are known. The individual proteins have molecular masses between 19-26 kD and consist of proteins with lengths of 156-166 and 172 amino acids. All IFN- alpha subtypes possess a common conserved sequence region between amino acid positions 115-151 while the amino-terminal ends are variable. Many IFN- alpha subtypes differ in their sequences at only one or two positions. Naturally occurring variants also include proteins truncated by 10 amino acids at the carboxyl-terminal end.
Image Unavailable-CAAAA12702-22

4-Hydroxybenzhydrazide 98%

Supplier: Thermo Scientific Chemicals
Description: 4-Hydroxybenzhydrazide 98%

Certificates

Image Unavailable-10389-574

Anti-CYP24A1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10389-574)
Supplier: Bioss
Description: Has a role in maintaining calcium homeostasis. Catalyzes the NADPH-dependent 24-hydroxylation of calcidiol (25-hydroxyvitamin D(3)) and calcitriol (1-alpha,25-dihydroxyvitamin D(3)). The enzyme can perform up to 6 rounds of hydroxylation of calcitriol leading to calcitroic acid. It also shows 23-hydroxylating activity leading to 1-alpha,25-dihydroxyvitamin D(3)-26,23-lactone as end product.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 70,143
no targeter for Bottom