You Searched For: 2,3-Dimethylphenylboronic+acid


74,615  results were found

SearchResultCount:"74615"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10084-388)
Supplier: Proteintech
Description: Anti-CD84 Antibody, Host Species: Rabbit, Cross Reactivity: Human, Immunogen: Recombinant Protein, 23-328 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, Recommended Storage: - 20 C or lower


Supplier: Thermo Scientific Chemicals
Description: Acidizing petroleum wells, chemical intermediate, ore reduction, food processing, pickling and metal cleaning, general cleaning, and laboratory reagent
Supplier: Peprotech
Description: FGF-acidic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. Recombinant Human FGF-acidic is a 16.8 kDa protein consisting of 141 amino acid residues.

Supplier: Prosci
Description: Prolactin is a neuroendocrine hormone secreted by the pituitary gland. Its primary function is to promote and maintain lactation during pregnancy and suckling. In addition, Prolactin plays an immune-regulatory role by stimulating the activities of ornithine decarboxylase and protein kinase C, which are important for the proliferation, differentiation, and function of lymphocytes. Recombinant human Prolactin is a 23 kDa globular protein containing 200 amino acid residues. Recombinant murine Prolactin is a 22.5 kDa globular protein containing 198 amino acid residues. Recombinant Rat Prolactin is a 22.6 kDa globular protein containing 198 amino acid residues.

Catalog Number: (10490-668)
Supplier: Bioss
Description: BPGM (2,3-bisphosphoglycerate mutase) is a 259 amino acid protein that belongs to the phosphoglycerate mutase family and exists as a homodimer that plays a crucial role in the regulation of hemoglobin oxygen. Specifically, BPGM catalyzes the conversion of 3-D-glyceroyl phosphate to 2,3-bisD-glycerate (2,3-BPG), a reaction that is essential for controlling the concentration of 2,3-BPG within the cell. The gene encoding BPGM maps to human chromosome 7, which houses over 1,000 genes and comprises nearly 5% of the human genome. Defects in some of the genes localized to chromosome 7 have been linked to Osteogenesis imperfecta, Williams-Beuren syndrome, Pendred syndrome, Lissencephaly, Citrullinemia and Shwachman-Diamond syndrome. Involvement in disease:Defects in BPGM are the cause of bisphosphoglycerate mutase deficiency (BPGMD) . A disease characterized by hemolytic anemia, splenomegaly, cholelithiasis and cholecystitis.


Supplier: Thermo Scientific Chemicals
Description: 7-Azaindole-5-boronic acid pinacol ester 97%
Catalog Number: (89419-720)
Supplier: Prosci
Description: RGPD5 peptide is used for blocking the activity of RGPD5 antibody.


Catalog Number: (RCRABH0022.5D1)
Supplier: Ricca Chemical
Description: Hydrochloric Acid, 37%, Trace Metals Grade, Cas number: 7647-01-0, 7732-18-5, Molecular Formula: HCl, H2O, Molecular weight: 36.46g/mol, 18.01g/mol, Appearance/Form: Colorless to slightly greenish-yellow liquid, Size: 2.50L Glass sc

Catalog Number: (89419-396)
Supplier: Prosci
Description: NogoA peptide is used for blocking the activity of NogoA antibody.


Catalog Number: (10110-250)
Supplier: Prosci
Description: ST6GALNAC4 is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. ST6GALNAC4 prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. ST6GALNAC4 is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. It is a member of glycosyltransferase family 29.The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to galactose-containing substrates. The encoded protein prefers glycoproteins rather than glycolipids as substrates and shows restricted substrate specificity, utilizing only the trisaccharide sequence Neu5Ac-alpha-2,3-Gal-beta-1,3-GalNAc. In addition, it is involved in the synthesis of ganglioside GD1A from GM1B. The encoded protein is normally found in the Golgi apparatus but can be proteolytically processed to a soluble form. This protein is a member of glycosyltransferase family 29. Transcript variants encoding different isoforms have been found for this gene.


Catalog Number: (10087-468)
Supplier: Proteintech
Description: Anti-GDF8/MYOSTATIN Antibody, Host Species: Rabbit, Cross Reactivity: Human,Mouse,Rat, Immunogen: Fusion Protein, 23-375 amino acid, Format:Antigen affinity purification, Application: ELISA, WB, IHC, Recommended Storage: - 20 C or lower


Supplier: Thermo Scientific Chemicals
Description: Diethyl suberate 99%
Catalog Number: (TCP1300-025G)
Supplier: TCI America
Description: CAS Number: 91-48-5
MDL Number: MFCD00004252
Molecular Formula: C15H12O2
Molecular Weight: 224.26
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 175

Supplier: TCI America
Description: 2,4-Diphenyl-6-[4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl]-1,3,5-triazine, Purity: >98.0%(GC), CAS no: 1219956-23-6, Molecular Formula: C27H26BN3O2, MW: 435.33, Form: Crystal - Powder, Size: 5G

Catalog Number: (75794-312)
Supplier: Prosci
Description: Tryptophan 2,3-dioxygenase (TDO) is a heme-containing dioxygenase catalyzing the addition of molecular oxygen across the 2,3-double bond of the indole ring of tryptophan to form N-formylkynurenine (NFK). In Anopheles gambiae, TDO is the only enzyme able to catalyze the first and rate-limiting step in L-Trp catabolism through the kynurenine pathway. Tryptophan is an essential amino acid for protein synthesis and also the precursor for production of a number of neurotransmitters, such as serotonin and melatonin; in mosquitoes, the kynurenine pathway is essential for eye pigmentation. Conceivably, the tryptophan-using pathways should be regulated in a coordinated manner in mosquitoes as well as in other species and TDO activation/inactivation processes could play an essential role in these phenomena.


Catalog Number: (103006-368)
Supplier: Anaspec Inc
Description: BNP-45 represents the 45 amino acids at the C-terminus and the mouse BNP-45 has all the amino acid residues thought essential for NP bioactivity, although sequence identity when studied with other BNP hormones (rat, 64%; dog, 53%; pig, 50%; and human, 44%) was clearly less than the identity among ANF hormones. The threonine 81 residue at which a protein kinase C phosphorylation site is present in the putative mature mouse BNP-45 hormone is not conserved in the rat sequence.
Sequence:SQDSAFRIQERLRNSKMAHSSSCFGQKIDRIGAVSRLGCDGLRLF (Disulfide bridge:23 - 39)
MW:5040.8 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
609 - 624 of 74,615
no targeter for Bottom