Print…

You Searched For: 2,2-Difluorocyclopropanecarboxylic+acid


70,781  results were found

Refine Results Sort by
SearchResultCount:"70781"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAA16699-03

Alizarin complexone, (max. 10% H₂O)

Supplier: Thermo Scientific Chemicals
Description: Alizarin complexone, (max. 10% H₂O)

Certificates

Product Image-97062-274

EDTA dipotassium salt dihydrate, Ultrapure

Catalog Number: (97062-274)
Supplier: VWR
Description: EDTA dipotassium salt dihydrate, Ultrapure

SDS Certificates


Image Unavailable-TCD0550-500G

Butopyronoxyl ≥95.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 532-34-3
MDL Number: MFCD00006574
Molecular Formula: C12H18O4
Molecular Weight: 226.27
Purity/Analysis Method: >95.0% (HPLC)
Form: Clear Liquid
Boiling point (°C): 113
Flash Point (°C): 157
Specific Gravity (20/20): 1.06

SDS Certificates

Image Unavailable-CAAAB20486-06

2,6-Bis(trifluoromethyl)benzoic acid 98%

Supplier: Thermo Scientific Chemicals
Description: 2,6-Bis(trifluoromethyl)benzoic acid 98%

Certificates

Image Unavailable-TCP0874-025G

PIPES disodium salt ≥98.0% (by titrimetric analysis)

Catalog Number: (TCP0874-025G)
Supplier: TCI America
Description: [Good's buffer component for biological research]
CAS Number: 76836-02-7
MDL Number: MFCD00064349
Molecular Formula: C8H18N2O6S2
Molecular Weight: 346.32
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White

SDS Certificates


Image Unavailable-10666-574

Anti-C22ORF31 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10666-574)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-76107-166

Anti-CCDC117 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76107-166)
Supplier: Bioss
Description: CCDC117 is a 279 amino acid protein that is expressed as multiple alternatively spliced isoforms and is encoded by a gene which maps to human chromosome 22. Chromosome 22 houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia. Additionally, translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia chromosome and the subsequent production of the novel fusion protein Bcr-Abl, a potent cell proliferation activator found in several types of leukemias.
Image Unavailable-76098-860

Anti-C22orf43 Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76098-860)
Supplier: Bioss
Description: C22orf43 (chromosome 22 open reading frame 43), also known as MGC33025 or MGC75009, is a 229 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-77440-718

Anti-EAN57 Rabbit Polyclonal Antibody

Catalog Number: (77440-718)
Supplier: Bioss
Description: EAN57 is a 59 amino acid protein encoded by the C22orf33 protein. Chromosome 22 contains over 500 genes and about 49 million bases. Being the second smallest human chromosome, 22 contains a surprising variety of interesting genes. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-76121-126

Anti-C22orf28 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76121-126)
Supplier: Bioss
Description: HSPC117, also known as C22orf28, is a 505 amino acid protein that is encoded by a gene which maps to human chromosome 22. A highly homologous protein identified in rodents, FAAP (focal adhesion associated protein), encoded by murine D10Wsu52e gene, has been suggested to play a role in regulating cell adhesion dynamics. Chromosome 22 houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia. Additionally, translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein BCR-Abl, a potent cell proliferation activator found in several types of leukemias.
Image Unavailable-CAAAH59899-06

3-Methyl-1H-pyrazole-5-carboxylic acid 97%

Supplier: Thermo Scientific Chemicals

Certificates

Image Unavailable-103007-216

Human [Lys22]-beta-Amyloid (1-42)

Catalog Number: (103007-216)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Product Image-CAJT2092-6

L(-)-Tryptophan 98.5-101.5% (dried basis) USP, Multi-Compendial, J.T.Baker®

Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: White crystals.

Certificates

Image Unavailable-76108-238

Anti-CCDC134 Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76108-238)
Supplier: Bioss
Description: Chromosome 22 contains over 500 genes and about 49 million bases. Being the second smallest human chromosome, 22 contains a surprising variety of interesting genes. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia. CCDC134 (coiled-coil domain containing 134), also known as MGC21013 or FLJ22349, is a 229 amino acid protein encoded by a gene mapping to human chromosome 22.
Image Unavailable-10666-576

Anti-C22ORF31 Rabbit Polyclonal Antibody (HRP (Horseradish Peroxidase))

Catalog Number: (10666-576)
Supplier: Bioss
Description: C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Image Unavailable-CA8.04107.0100

Glyoxylic acid monohydrate for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Cas Number 563-96-2, Chemical Formula Ochcooh * H2O, For Synthesis

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
337 - 352 of 70,781
no targeter for Bottom