You Searched For: Anaspec Inc

Supplier: Anaspec Inc

Description: Aß (25-35) is the main factor responsible for Aß neurotoxic effects.

Catalog Number: (103006-412)

Supplier: Anaspec Inc

Description: (Arg)9 is a cell-permeable peptide used for drug delivery.It can traverse the plasma membrane of eukaryotic cells. This is a fluorescent (FAM)-labeled cell permeable peptide, Abs/Em = 494/521 nm.
Sequence:FAM-RRRRRRRRR
MW:1782 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-238)

Supplier: Anaspec Inc

Description: Indolicidin, a member of the cathelicidin protein family, is a 13-residue cationic, antimicrobial peptide-amide isolated from the cytoplasmic granules of bovine neutrophils. Indolicidin is microbicidal in-vitro against gram-positive and gram-negative bacteria, fungi, protozoa, and human immunodeficiency virus (HIV-1).
Sequence:ILPWKWPWWPWRR-NH2
MW:1906.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-258)

Supplier: Anaspec Inc

Description: Melan-A is a melanocyte differentiation antigen recognized by cytotoxic T lymphocytes. This sequence is a naturally presented Melan-A/MART-1 nonamer peptide. The Melan-A/MART-1 gene is expressed by normal melanocytes, as well as by most fresh melanoma samples and melanoma cell lines. This peptide appears to be a very common immunogenic epitope for HLA-A2-restricted melanoma-specific tumor-infiltrating lymphocytes (TIL) and may be useful for the development of immunotherapeutic strategies.
Sequence:AAGIGILTV
MW:814.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-304)

Supplier: Anaspec Inc

Description: Excellent reagent for detecting polyhistidine-containing biomolecules

Catalog Number: (103007-212)

Supplier: Anaspec Inc

Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-404)

Supplier: Anaspec Inc

Description: Substance P (SP) is an important neuropeptide belonging to the tachykinin family. It acts as a neurotransmitter and neuromodulator. It is closely related to neurokinin A, both originating from the same precursor preprotachykinin A. It is released from the terminals of sensory nerves and is involved in inflammation and pain processes. This peptide is a fluorescent (FAM)-labeled Substance P, Abs/Em = 494/521 nm.
Sequence:FAM-RPKPQQFFGLM-NH2
MW:1706 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-856)

Supplier: Anaspec Inc

Description: TAMRA-X contains a seven-atom aminohexanoyl spacer (known as ‘X’) between TAMRA fluorophore and the succinimidyl ester. The ‘X’ spacer separates the fluorophore from the biomolecule to which it is conjugated, potentially reducing the quenching that typically occurs upon conjugation. We recommend this TAMRA-X derivative as the preferred dye for preparing TAMRA-labeled proteins when the fluorescence quenching of the labeling dye by protein is a serious problem.

Supplier: Anaspec Inc

Description: This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26)
MW:3464.1 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (102997-814)

Supplier: Anaspec Inc

Description: MOG peptide fragment (35-55) induces autoantibody production and relapsing-remitting neurological disease causing extensive plaque-like demyelination

Catalog Number: (102999-762)

Supplier: Anaspec Inc

Description: This C-terminally labeled biotin ACTH (1-39) has been used in ELISA assays. This 39 amino acid-peptide hormone is produced in the anterior pituitary gland upon stimulation by the corticotropin releasing hormone from the hypothalamus in response to stress. It stimulates the secretion of steroid hormone, specifically glucocorticoids in the adrenal cortex by acting through a cell membrane receptor (ACTH-R).
Sequence: Biotin - SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF
MW: 4768.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103003-370)

Supplier: Anaspec Inc

Description: Mammalian defensins are abundant in the cytoplasmic azurophilic granules of neutrophils, Paneth cells of the small intestine and some macrophages. Human a-defensin-1 (HNP-1) is a peptide possessing both broad antimicrobial (both Gram-positive and Gram-negative bacteria) and cytotoxic activities. HNP-1 reduces adenoviral infection by more than 95%.
Sequence:ACYCRIPACIAGERRYGTCIYQGRLWAFCC (Disulfide bridge: 2-30, 4-19, 9-29)
MW:3442.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-470)

Supplier: Anaspec Inc

Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103006-560)

Supplier: Anaspec Inc

Description: This peptide is a rat homologue of the human cathelicidin LL-37. Rat cathelicidin-related antimicrobial peptide (rCRAMP) was identified in granulocytes, thymus, testis, lung, mouth mucosa, tongue, oesophagus, colon, caecum and small intestine. The rCRAMP peptide is present in specific CNS regions and may play a role in the innate immunity of the CNS. rCRAMP exhibits pro-healing activity in stomach.
Sequence:GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ
MW:3946.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-200)

Supplier: Anaspec Inc

Description: This fibrinogen-derived inhibitory peptide attenuates microglia activation and suppresses relapsing paralysis in multiple sclerosis (MS). Targeting this gamma- fibrinogen epitope could represent a potential therapeutic strategy for MS and other neuroinflammatory diseases associated with blood-brain barrier disruption and microglia activation.
Sequence:YSMKETTMKIIPFNRLSIG
MW:2229.7 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C