You Searched For: Anaspec Inc

Catalog Number: (102996-438)

Supplier: Anaspec Inc

Description: This is a fluorescent peptide, Abs/Em=380/500. It is a substrate for dipeptidyl peptidase IV (DPP IV) and Xaa-Pro dipeptidase.
Sequence:AP-AFC
MW:397.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-584)

Supplier: Anaspec Inc

Description: This peptide is Bac2A, a linear variant of the loop-shaped cationic antimicrobial peptide Bactenecin found in bovine neutrophils. The Cys disulfide bond-forming residues of Bactenecin is replaced with Ala in Bac2A, and is active against both gram-positive and gram-negative bacteria.
Sequence:RLARIVVIRVAR-NH2
MW:1420.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: This fluorescent (FITC)-labeled TAT peptide contains a long chain (LC) to prevent FITC from degradation. Abs/Em = 493/522 nm.
Sequence: FITC-LC-YGRKKRRQRRR-NH2
MW: 2061.4 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103004-134)

Supplier: Anaspec Inc

Description: Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.
Sequence:Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
MW:4296 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-446)

Supplier: Anaspec Inc

Description: This is a fluorescent glandular kallikrein substrate, Abs/Em=380/500 nm.
Sequence:vLR-AFC
MW:597.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-578)

Supplier: Anaspec Inc

Description: This peptide is derived from the human mucin MUC5AC gene sequence. Data suggest that MUC5A and MUC5C are part of the same gene MUC5AC, which is distinct from MUC5B. The gene MUC5AC is mainly expressed in gastric, tracheo-bronchial mucosae and some tumors, it exhibits two kinds of deduced peptide domains, one of which is 8 amino acid tandemly repeated domain, a consensus peptide TTSTTSAP.
Sequence:GTTPSPVPTTSTTSAP
MW:1501.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4534.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-358)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-520)

Supplier: Anaspec Inc

Description: Dermcidin-1L (DCD-1L) is a 48-amino acid antimicrobial peptide (AMP) with a Leu residue on the C-terminus. It is expressed in eccrine sweat glands, secreted into sweat, and transported to the epidermal surface. Unlike most AMPs, which are cationic, DCD has a net negative charge.
Sequence:SSLLEKGLDGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
MW:4818.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-040)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 31 to 41 tri-methylated at Lys-36.
Sequence:STGGV-K(Me3)-KPHRY
MW:1271.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103006-684)

Supplier: Anaspec Inc

Description: This peptide is a major histocompatibility complex class II (MHC-II)-restricted peptide, LLO190 (NEKYAQAYPNVS), from the listeriolysin O protein of Listeria monocytogenes, which generates an LLO190-specific Th response.
This peptide subsequently challenges recombinant L. monocytogenes expressing the MHC-I-restricted epitope of ovalbumin (Ova257, SIINFEKL).
Sequence:NEKYAQAYPNVS
MW:1383.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-674)

Supplier: Anaspec Inc

Description: This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and analysis studies.
Sequence: Biotin-LC-LLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
MW: 4832.8 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a fluorogenic substrate that is best cleaved by MMP-7, 8, 9 and 13. The highly fluorescent Mca moiety is efficiently quenched by energy transfer to the Dnp group. The punctuated metallo proteinase (PUMP, EC 3.4.24.23) cleaves the substrate at the Gly-Leu bond with a 190-fold increase in fluorescence (Abs/Em = 325/393 nm). In human MMP assays, this substrate is about 50 to 100 times more sensitive than the generic MMP substrate, Dnp-PLGLWAr-NH2.
Sequence:Mca-PLGL-Dap(Dnp)-AR-NH2
MW:1093.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-716)

Supplier: Anaspec Inc

Description: This is amino acids 15 to 23 fragment of the insulin beta chain recognized by islet-associated T cells. This peptide is also known as INS. It was used in diabetes studies to assay the IFN-beta and IL-17 production by diabetogenic CD4 or CD8 T cells. This peptide stains the INS-reactive CTL clone, but doesn’t stain the splenic CD8+ T cells from NOD or 8.3-TCR-transgenic NOD mice.
Sequence: LYLVCGERG
MW: 1009.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-372)

Supplier: Anaspec Inc

Description: Biotin, SE is amino-reactive biotinylating reagent for peptides and proteins; it has a better avidin-binding affinity than biotin. Biotin, SE (d-Biotin-N-hydroxysuccinimide ester, Biotin, NHS ester) contains a five-carbon spacer arm that reduces steric hindrance associated with binding four biotinylated molecules per one avidin and results in enhanced detection sensitivity.

Catalog Number: (103007-380)

Supplier: Anaspec Inc

Description: This peptide is the capsid derived immunodominant adeno-associated virus 2 (AAV2), CD8 T cell epitope. Liver toxicity observed in a clinical trial of AAV2 delivered systemically to patients with hemophilia was ascribed to killing of vector-transduced hepatocytes by capsid-specific T-cells.
Sequence:VPQYGYLTL
MW:1053.2 Da
% peak area by HPLC:95
Storage condition:-20° C