You Searched For: Anaspec Inc

Catalog Number: (103009-616)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine. It is tri-methylated at lysine 20.
Sequence:Ac-KGLGKGGAKRHR-K(Me3)-VLRDNIQGITWG-K(biotin)
MW:3184.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-960)

Supplier: Anaspec Inc

Description: Histone deacetylase (HDAC) enzymes modulate gene expression through the deacetylation of lysine residues on histone proteins and act as transcriptional repressors of genes

Catalog Number: (103010-302)

Supplier: Anaspec Inc

Description: MMP-10 (stromelysin 2) cleaves extracellular matrix proteins, but is unable to cleave the triple-helical fibrillar collagens

Catalog Number: (103010-292)

Supplier: Anaspec Inc

Description: The SensoLyte® Plus 520 MMP-13 Assay Kit is designed for specifically detecting MMP-13 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-13 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-13-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Catalog Number: (102996-708)

Supplier: Anaspec Inc

Description: A potent peptide inhibitor of Hepatitis Virus C NS3 protease.

Catalog Number: (103007-134)

Supplier: Anaspec Inc

Description: This peptide is a nuclear receptor (NR) box B3 region of the p160 co-activator Transcriptional Intermediary Factor 2 (TIF2) peptide, a LXXLL motif. The activation function 2/ligand-dependent interaction between nuclear receptors and their co-regulators is mediated by a short consensus motif nuclear receptor box.
Sequence:KENALLRYLLDKDD
MW:1705.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-624)

Supplier: Anaspec Inc

Description: Factor Xa (FXa) is a serine endopeptidase composed of two disulfide-linked subunits

Catalog Number: (103007-788)

Supplier: Anaspec Inc

Description: This peptide is derived from rat angiotensinogen amino acid residues 1-14. It is a synthetic renin substrate.
Sequence: DRVYIHPFHLLYYS
MW: 1823.1 Da
% Peak area by HPLC: 95
Storage condition: -20°C

Catalog Number: (103008-312)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 amino acid residues 1-21. It is acetylated at lysine 18 with a C-terminal GG linker followed by a biotinylated lysine. The acetylation of histone H3 at lysine 18 is used to predict prostrate cancer recurrence and clinical outcome of patients with both lung and kidney cancer. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ARTKQTARKSTGGKAPR-K(Ac)-QLA-GGK(Biotin)-NH2
MW:2764.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103002-968)

Supplier: Anaspec Inc

Description: Beta-amyloid N-terminally truncated (9-42) peptide. The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down’s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified.
Sequence: GYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3556.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103010-484)

Supplier: Anaspec Inc

Description: Renin, a highly specific aspartyl protease, cleaves angiotensinogen, produced in the liver, to yield angiotensin I, which is further converted into angiotensin II by ACE (Angiotensin Converting Enzyme). Angiotensin II constricts blood vessels, leading to increased blood pressure. It also increases the secretion of ADH and aldosterone, and stimulates the hypothalamus to activate the thirst reflex. Since an overactive renin-angiotensin system leads to hypertension, renin is proposed as a therapeutic target for this disease.

Recombinant rat pro-renin was expressed in HEK cells. Purified enzyme was converted to the active renin by tryptic activation followed by removal of trypsin. The molecular mass of active rat renin is approximately 40 kDa. The activity of enzyme can be measured in FRET-based assays

Catalog Number: (103006-588)

Supplier: Anaspec Inc

Description: This is a HLA-A*0201–restricted peptide derived from melanoma antigens encoded by MAGE-3.
Sequence:FLWGPRALV
MW:1058.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-664)

Supplier: Anaspec Inc

Description: The SensoLyte® Plus 520 MMP-2 Assay Kit is designed specifically for detecting MMP-2 activity in biological samples, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate, which may contain multiple MMPs. A monoclonal anti-human-MMP-2 antibody is employed to pull down MMP-2 from the mixture first. MMP-2 activity is then quantified by a 5-FAM/QXL® 520 fluorescence resonance energy transfer (FRET) peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-2-induced cleavage of the FRET substrate. The long wavelength fluorescence of 5-FAM is less interfered by the autofluorescence of components in biological samples and test compounds. Ample materials are provided to perform 96 assays in a 96-well format.

Catalog Number: (103005-940)

Supplier: Anaspec Inc

Description: Matrix Metalloproteinases (MMPs) are a large family of endopeptidases. Collectively, MMPs can degrade all kinds of extracellular matrix proteins, and can also process a number of bioactive molecules. They are known to be involved in the cleavage of cell surface receptors, the release of apoptotic ligands, and chemokine/cytokine inactivation. MMPs are also thought to play a major role in cell behaviors such as cell proliferation, migration (adhesion/dispersion), differentiation, angiogenesis, apoptosis, and host defense.
This peptide is a sensitive substrate for assaying MMP-3 and 12 activities, Abs/Em = 494/521nm.
Sequence:5-FAM-RPKPVE-Nva-WRK(QXL™ 520)-NH2
MW:2143.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (102996-382)

Supplier: Anaspec Inc

Description: This peptide is PACAP (1-38) with a Biotin label on its N-terminus. Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase EC50=7 nM.
Sequence: Biotin-HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4761.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103008-276)

Supplier: Anaspec Inc

Description: This peptide corresponds to amino acids 26 to 46 of human histone H3. It is dimethylated at lysine-36, followed by a biotinylated lysine. The methylation of histone H3 at lysine 36 (K36) has recently been shown to be associated with RNA polymerase II (Pol
Sequence:RKAAPATGGV-K(Me2)-KPHRYRPGTV-K(Biotin)
MW:2630.1 Da
% peak area by HPLC:95
Storage condition:-20° C