You Searched For: Anaspec Inc

Catalog Number: (102999-772)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: Biotin-SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4984.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103007-624)

Supplier: Anaspec Inc

Description: This is a myristoylated PKCζ pseudosubstrate-derived ζ-inhibitory peptide (ZIP) found to inhibit an atypical type of Protein Kinase C ζ (zeta). It has been shown to also interact with PKC family isoforms and disrupt conventional PKC targeting and translocation leading to physiological memory impairment. The sequence corresponds to the pseudosubstrate region of the N-terminal regulatory domain that maintains the enzyme in an inactive form in the absence of activator. The pseudosubstrate peptide has also been shown to be a competitive inhibitor of PKCζ in neurons. This peptide was also used to demonstrate that PKC ζ is involved in the regulation of integrin-dependent adhesion and chemotaxis of intact human neutrophils.
Sequence:Myr-SIYRRGARRWRKL
MW:1928.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103005-926)

Supplier: Anaspec Inc

Description: Aggrecanases belong to the ADAMTS (A disintegrin and metalloprotease with thrombospondin motif) family of proteases. Aggrecanases cleave aggrecan, the major structural component of cartilage. Aggrecanase-1 (ADAMTS-4) is a major aggrecanase in human osteoarthritic cartilage.
This FRET peptide was used in an ADAMTS-4 (Aggrecanase-1) assay. Ex/Em = 340/420 nm.
Sequence:Abz-TEGEARGSVI-Dap(Dnp)-KK-NH2
MW:1644.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-964)

Supplier: Anaspec Inc

Description: ACE2 or ACEH, angiotensin-converting enzyme 2, a homolog of angiotensin-converting enzyme, is a novel zinc metallopeptidase with specificity, tissue distribution, and function distinct from those of ACE

Catalog Number: (103006-268)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:RQIKIWFQNRRMKWKK
MW:2246.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-350)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-23) with deimination at Arg3. It contains a C-terminal GGK linker with biotinylation on the side chain of this Lys. Deimination of Arg3 to Cit is carried out by peptidylarginine deiminase (PADI)-4. Although the function of deimination is not clearly known, it has been shown to inhibit Arg methylation and repress nuclear hormone receptor-dependent gene activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SG-Cit-GKGGKGLGKGGAKRHRKVLR-GGK(Biotin)
MW:2830.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103011-006)

Supplier: Anaspec Inc

Description: Tetramethylrhodamine-5 C2 maleimide is a good alternative to tetramethylrhodamine-5-maleimide with excitation/emission wavelength at 544/572 nm. Its spectral characteristics are very close to those of tetramethylrhodamine-5-maleimide (+2 nm). It is 40% less expensive compared to tetramethylrhodamine-5-maleimide, and can be used for thiol modification of proteins, antibodies and peptides.

Catalog Number: (103010-388)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-10 (stromelysin 2) is involved in several pathological conditions, such as cancer, arthritis and wound healing. MMP-10 is secreted as zymogen with a prodomain, a catalytic domain, a hinge region, and a hemopexin-like domain. It can activate other MMPs such as MMP-1, MMP-8 and degrade a variety of substrates, including gelatin, collagens III, IV and V, fibronectin, aggrecan

This recombinant human MMP-10 was expressed as a pro-enzyme enzyme from its DNA sequence7 transfected into a mouse myeloma cell line, NS0. The apparent Mr on SDS-PAGE is 58-kDa. Incubation with 1 mM APMA at 37°C for 1-2 hours will activate pro-MMP-10. Its activity can be measured by FRET peptides

Catalog Number: (103009-750)

Supplier: Anaspec Inc

Description: This peptide is based on amino acids 73 to 83 of histone H3. Lysine 79 of Histone H3 (H3K79) has been identified as a residue for acetylation or methylation.Related Peptides: [Lys(Ac)79]-Histone H3 (73-83), H3K79(Ac), Cat# 65438 [Lys(Me3)79]-Histone H3(73-83), H3K79(Me3), Cat# 65439[Lys(biotin)79]-Histone H3 (73-83), H3K79(biotin), Cat# 65440
Sequence:EIAQDFKTDLR
MW:1336.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-696)

Supplier: Anaspec Inc

Description: VIP (1−12), vasoactive intestinal peptide fragment 1-12 with a mass of 1425.5 da, is mostly used as a standard in mass spectrometry
Sequence:HSDAVFTDNYTR
MW:1425.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This sequence acts as a tethered peptide ligand. Free SFLLRN activates PAR1 independent of receptor cleavage and has been used to probe PAR1 function in various cells and tissues. This peptide is also known to be capable of activating PAR2.
Sequence:SFLLRN
MW:748.9 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Catalog Number: (103003-186)

Supplier: Anaspec Inc

Description: This peptide is amino acids 46 to 61 fragment of the hen egg lysozyme (HEL). Lysozyme is anti-bacterial enzyme found in high concentration in the egg white. HEL was used in MHC related studies, and tested as a part of antimicrobial vaccines.
Sequence:NTDGSTDYGILQINSR
MW:1753.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-714)

Supplier: Anaspec Inc

Description: The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence: SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2
MW: 4757.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-184)

Supplier: Anaspec Inc

Description: The AnaTag™ R-PE Labeling Kit is optimized for use in the conjugation of R-Phycoerythrin (R-PE) to antibodies. R-PE, a fluorescent protein from phycobiliprotein family, has broad absorption bands with peaks at 565 nm (eM =1.96 x 106 M^-1cm-¹), 498 (eM =1.53 x 106 M^-1cm^-1), and 539 nm (eM =1.62 x 106 M^-1cm^-1); it therefore can be excited with versatile excitation sources. Its maximal emission can be detected at 578 nm. The broad excitation spectrum also provides the advantage of multi-color immunofluorescent staining or cell sorting. R-PE and the closely related B-PE are the most intensely fluorescent phycobiliproteins having orange fluorescence. They are significantly brighter and more photostable than conventional organic fluorophores. The AnaTagTM R-PE Labeling Kit contains SH-reactive R-PE. SMCC modified R-PE reacts with the thiol groups of target antibody without the need for additional activation, thus simplifying the conjugation protocol. The amount of R-PE supplied in this kit is sufficient for labeling up to 1 mg of antibody. The kit provides all reagents, purification columns and a detailed step-by-step protocol. Native and SMCC-activated R-PE are also available as separate products.

Supplier: Anaspec Inc

Description: Myelin Oligodendrocyte Glycoprotein (MOG) is a member of the immunoglobulin superfamily and is expressed exclusively in the central nervous system (CNS). Although MOG protein constitutes only 0.01-0.05% of the CNS myelin proteins, it was demonstrated that MOG protein is a crucial autoantigen for multiple sclerosis in humans and experimental autoimmune encephalomyelitis (EAE) in rodents and monkeys

The sequence (Accession # NP_034944) corresponding to the extracellular domain of mouse MOG along with a 6x His tag was expressed in E. coli. The recombinant mouse MOG (M-rMOG) was purified from urea denatured bacterial lysate using immobilized metal affinity chromatography (IMAC). The molecular mass of the recombinant mouse MOG is 14.2 kDa

Catalog Number: (102996-442)

Supplier: Anaspec Inc

Description: This is a fluorescent Thrombin substrate, Abs/Em=380/500 nm.
Sequence:fPR-AFC
MW:629.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C