You Searched For: Anaspec Inc

Catalog Number: (103008-564)

Supplier: Anaspec Inc

Description: This peptide is the H2-Kd-restricted epitope of Listeriolysin O (LLO), consisting of amino acids 91 to 99. LLO is necessary for Listeria monocytogenes to escape the vacuoles of host cells and enter the cytoplasm during infection. This fragment has been shown to be a potential vaccine candidate against L. monocytogenes by eliciting a CTL response in vivo.
Sequence:GYKDGNEYI
MW:1058.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 488 acid, SE is an excellent amine-reactive fluorescent labeling dye that generates the protein conjugates far superior to those of fluorescein derivatives such as FITC.

Catalog Number: (103011-034)

Supplier: Anaspec Inc

Description: This product is a very useful building block and a good transglutaminase substrate.

Supplier: Anaspec Inc

Description: Although FITC reagents have been more often used to prepare fluoresceinated bioconjugates, the low stability of FITC bioconjugates makes some researchers use amine-reactive succinimidyl esters of carboxyfluorescein (commonly called FAM) in bioconjugations. FAM reagents give carboxamides that are more resistant to hydrolysis. We have shown that FAM reagents require less stringent reaction conditions and give better conjugation yields, and the resulted conjugates have superior stability. We noted that FITC labeled peptides tend to deteriorate more quickly than the corresponding FAM conjugates.

Catalog Number: (103007-188)

Supplier: Anaspec Inc

Description: This peptide corresponds to the myelin basic protein (MBP) encephalitogenic epitope used to induce experimental autoimmune encephalomyelitis (EAE) in rats. It corresponds to amino acids 69-85 from guinea pig MBP.
Sequence:YGSLPQKSQRSQDENPV
MW:1933.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-620)

Supplier: Anaspec Inc

Description: This peptide is Histone H4 amino acid residues 1-25. It is acetylated at lysine 5/8/12/16.
Sequence:SGRG-K(Ac)-GG-K(Ac)-GLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGSK
MW:2373.7 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42. Additional minor Aβ peptides are also normally produced, such as Beta-amyloid 1-34, 1-37, 1-38 and 1-39, and few reports have quantified the levels of these peptides in the brain.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG
Molecular Weight: 4074.6 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: West Nile virus (WNV) is a member of the flavivirus genus, which contains many significant human pathogens including Dengue virus (Den), Japanese Encephalitits virus (JE), and Yellow Fever virus (YF). WNV is a small, enveloped virus with a single stranded, positive sense 11kb RNA genome, which encodes a polyprotein precursor. This polyprotein must be cleaved co- and post-translationally to produce ten functional proteins: three structural (C, prM and E) and 7 nonstructural (NS1, NS2A, NS2B, NS3, NS4A,NS4B and NS5). WNV NS3 protease is absolutely essential (along with viral-encoded cofactor NS2B) for post-translational cleavage and viral replication. As a result, this protease is a potential therapeutic target.

His-tagged recombinant WNV NS3 protease (residues 1 to 184) was expressed as a fusion protein with the cofactor NS2b (residues 49 to 96) and a linker sequence (GGGGSGGGG) in E. coli. The apparent Mr on SDS-PAGE is 32-kDa. Its activity can be measured by FRET peptides

Catalog Number: (103006-576)

Supplier: Anaspec Inc

Description: This peptide is a fragment of the human aquaporin-2 (AQP2) phosphorylated at Ser261. Protein phosphorylation plays a key role in vasopressin signaling in renal-collecting duct. Phosphorylation at several AQP2 residues including Ser256 and Ser261, is altered in response to vasopressin. It is possible that both sites are involved in vasopressin-dependent AQP2 trafficking.
Sequence: RQSVELH-pS-PQSLPR
MW: 1713.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103002-946)

Supplier: Anaspec Inc

Description: The native peptide PKTPKKAKKL (60026-1) is derived from histone H1 peptide sequence that is docked in the active site of cyclin-dependent kinase 5. It is an effective CDK5 substrate (Km = 40 µM).
Sequence:PKTPKKAKKL
MW:1138.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: The sequence (Accession # AAC04279.1) corresponding to the full length human Tau-441 (2N4R isoform) protein along with GST tag at N-terminal was expressed in E. coli. The recombinant GST-Tau-441 protein was purified from bacterial lysate using proprietary method.
Microtubule associated protein (Tau) is found predominantly in the central neural system and its major function is to promote assembly and to stabilize neuronal microtubules. Six isoforms of Tau were identified in humans that are differentiated by the exclusion or inclusion of exons 2, 3, and 10. Tau-441 is the longest of Tau isoforms, consisting of 441 amino acids with molecular mass of 45.8 kDa. Under physiological conditions Tau can undergo abnormal phosphorylation, truncation, or other modifications that result in the protein detachment from microtubules. These modified Tau molecules can self-associate and form different types of aggregates including neurofibrillary tangles (NFTs) found in brains of patients with neurodegenerative diseases such as Alzheimer’s disease.

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4233.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: This is a synthetic peptide substrate for S6 kinase shown to be phosphorylated by protein kinase c with phosphorylation site identified at Ser235.
Sequence:AKRRRLSSLRA
MW:1313.6 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103008-438)

Supplier: Anaspec Inc

Description: This fluorescent (FITC)-labeled OVA (323 - 339) Peptide is an H-2b-restricted OVA class II epitope (Abs/Em = 493/522 nm).
Sequence: FITC-LC-ISQAVHAAHAEINEAGR
MW: 2276.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103006-346)

Supplier: Anaspec Inc

Description: This peptide inhibits the adhesion of human ovarian carcinoma OVCAR-3 cells to fibronectin, but not to laminin.
Sequence:GRGDS-NH2
MW:489.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103003-350)

Supplier: Anaspec Inc

Description: The fibrinogen binding inhibitor peptide is important for platelet aggregation. The sequence is derived from the carboxy terminus of the gamma chain of fibrinogen (residues 400-411). This is considered one of the common ligands for glycoprotein (GPIIb-IIIa) recognition and binding.
Sequence:HHLGGAKQAGDV
MW:1189.4 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C