You Searched For: Anaspec Inc

Catalog Number: (103003-710)

Supplier: Anaspec Inc

Description: Caerulein, a decapeptide analog of the potent pancreatic secretagogue cholecystokinin, stimulates gastric, biliary, and pancreatic secretion. Caerulein injections cause acute pancreatitis in mice.
Sequence: Pyr-QD-Y(SO3H)-TGWMDF-NH2
MW: 1352.4 Da
% Peak area by HPLC: 95
Storage condition:

Catalog Number: (103010-584)

Supplier: Anaspec Inc

Description: This human recombinant SIRT2 is in its active form, and can be used for enzyme activity assays. The recombinant human Sirtuin 2 (GenBank Accession #: NM_030593) with 13-319 amino acids and His tag at its C-terminal was expressed in E. coli. The molecular mass of the enzyme is approximately 35.5 kDa on SDS-PAGE.
Sirtuins comprise a unique class of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases (class III HDACs) targeting multiple protein substrates.
Sirtuin 1 (SIRT1), the human homolog of yeast Sir2 (Silent Information Regulator 2), is the most studied of the seven members of sirtuin family. SIRT1 have been implicated in several important cellular processes, including genomic stability and DNA repair, p53-mediated apoptosis, adipogenesis, and aging.
Substrates for SIRT2 are not limited to histones but also include various transcription factors and co-regulators that modulate metabolic, cell cycle and cell death related pathways. Human SIRT2 is a cytoplasmic protein that increases in abundance during mitosis and regulates major events of cytokinesis.

Catalog Number: (103009-022)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) with substitution of Phe19 to Pro. This substitution inhibits amyloid fibril formation, which is implicated in neurodegenerative diseases such as Alzheimer’s.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103006-506)

Supplier: Anaspec Inc

Description: This is amino acids 1 to 40 fragment of human beta-amyloid differing from those in rat, mouse by three amino acid residues in Arg5, Tyr10, and His13. This peptide is biotinylated at the C-terminus.

Catalog Number: (103010-412)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Catalog Number: (103011-026)

Supplier: Anaspec Inc

Description: 5-FTSC reacts with ketones to yield relatively stable hydrazones and with aldehydes to yield hydrazones that are somewhat less stable, though they may be formed faster (compared to ketones). These hydrazones are generally reduced with sodium borohydride (NaBH4) to further increase the stability of the linkage. 5-FTSC has been used to make a wide variety of biomolecules such as L-aspartase-a-decarboxylase, enzyme-oxidized live plant protoplasts, immunoglobulins, thrombin and antithrombin.

Catalog Number: (103007-680)

Supplier: Anaspec Inc

Description: This is amino acid sequence of rat C-peptide-1. C-peptide binds specifically to cell surfaces, probably to a G protein-coupled surface receptor, with subsequent activation of Ca2+-dependent intracellular signaling pathways. It also stimulates Na+-K+-ATPase and endothelial nitric oxide synthase activities. Rat C-peptide was found to diminish glucose-stimulated insulin release in rats both in vivo and in vitro.
Sequence: EVEDPQVPQLELGGGPEAGDLQTLALEVARQ
MW: 3259.6 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103002-744)

Supplier: Anaspec Inc

Description: This is a fluorescent (FITC)-labeled Erythropoietin (EPO)-mimetic peptide (EMP17), Abs/Em=494/520 nm. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: FITC-LC-TYSCHFGPLTWVCKPQGG
MW: 2483.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103006-122)

Supplier: Anaspec Inc

Description: This is a BCL2-antagonist of cell death peptide fragment that is fluorescently labeled with FAM, Abs/Em=494/521 nm.
Sequence:FAM-NLWAAQRYGRELRRMSDEFVDSFKK
MW:3461.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-918)

Supplier: Anaspec Inc

Description: This peptide is Histone 3, with amino acid residues 21 to 44. It is dimethylated at Lys27 and monomethylated Lys36, with a C-terminal G linker followed by a biotinylated lysine. Histone methylation plays an important role in the regulation of chromatin structure and function. 
Sequence:ATKAAR-K(Me2)-SAPATGGV-K(Me1)-KPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-972)

Supplier: Anaspec Inc

Description: The Antennapedia homeodomain protein of Drosophila has the ability to penetrate biological membranes and the third helix of this protein, residues 43-58, known as penetratin (RQIKIWFQNRRMKWKK-amide) has the same translocating properties as the entire protein.
Sequence:5-FAM-RQIKIWFQNRRMKWKK-NH2
MW:2604.1 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-900)

Supplier: Anaspec Inc

Description: DEAC, SE is an excellent blue fluorescent building block for labeling amine-containing biomolecules.

Catalog Number: (103011-378)

Supplier: Anaspec Inc

Description: BSB, derived from the structure of Congo Red, is shown to bind to a wide range of amyloid inclusions in situ.

Catalog Number: (103003-546)

Supplier: Anaspec Inc

Description: This C-terminal biotinylated Aß(1-40) contains a 6-carbon long chain (LC) to provide more accesibility for avidin attachment.

Catalog Number: (103010-160)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components

Catalog Number: (102999-346)

Supplier: Anaspec Inc

Description: This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 40-1.
Sequence: VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD
Molecular Weight: 4329.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C