You Searched For: Anaspec Inc

Catalog Number: (103007-136)

Supplier: Anaspec Inc

Description: This peptide is the beta-Amyloid peptide, residues 1 to 16 labeled with HiLyte™ Fluor 488 on the Lys16, Abs/Em =501/527.
Sequence: DAEFRHDSGYEVHHQ-K(HiLyte™ Fluor 488)
Molecular Weight: 2311.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-798)

Supplier: Anaspec Inc

Description: Calpains are a family of intracellular Ca2+ dependent cysteine proteases. They respond to Ca2+ signals by cleaving many specific proteins, thereby irreversibly modifying their function(s). They are implicated in a variety of Ca2+ regulated cellular processes as well as various pathological phenomena, such as ischemic injury, muscular dystrophy, diabetes, cataract, atherosclerosis, Alzheimer’s disease, and cancer. Calpains represent potential therapeutic targets for drug discovery.
This 7-amino-4-methylcoumarin (AMC) labeled peptide is widely used as a fluorogenic substrate for 20S proteasome, calpains and other chymotrypsin-like proteases. Cleavage of this AMC peptide by the enzymes generates strongly fluorescent AMC that is monitored fluorimetrically at Abs/Em=353/442 nm.
Sequence:Suc-LLVY-AMC
MW:763.9 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Anaspec Inc

Description: Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients.
Sequence:KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2
MW:4003.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-172)

Supplier: Anaspec Inc

Description: This short synthetic peptide facilitates efficient transdermal protein drug delivery through intact skin. Co-administration of the peptide and insulin to the abdominal skin of diabetic rats results in elevated systemic levels of insulin and suppresses serum glucose levels. This peptide creates a transient opening in the skin barrier to enable macromolecular drugs to reach systemic circulation.
Sequence:ACSSSPSKHCG
MW:1063.2 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-962)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor594 hydrazide is a carbonyl-reactive fluorescent labeling dye. It can be used for labeling glycoproteins such as HRP.

Catalog Number: (103010-360)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Catalog Number: (103010-544)

Supplier: Anaspec Inc

Description: Cathepsin D is the lysosomal aspartic proteinase, active in intracellular protein breakdown

Catalog Number: (103008-282)

Supplier: Anaspec Inc

Description: This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence:KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
MW:3616.4 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103009-890)

Supplier: Anaspec Inc

Description: This peptide is histone H4 (1-25) with acetylation at Lys5. It is biotinylated through a C-terminal GSGSK linker. Acetylation at Lys5 plays a role in histone deposition and transcriptional activation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:SGRG-K(Ac)-GGKGLGKGGAKRHRKVLRDN-GSGSK(Biotin)
MW:3274.8 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103007-638)

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) with substitution of Ser26 to Cys. This peptide has been used in a number of fluorescent tagged experiments and suited for fluorescent probe labeling.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVVIA
MW: 4530.2 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier: Anaspec Inc

Description: 5-FAM, SE is a single isomer. It is one of the most popular green fluorescent reagents used for labeling peptides, proteins and nucleotides. It has also been used to prepare various small fluorescent molecules.

Catalog Number: (103003-006)

Supplier: Anaspec Inc

Description: The synthetic peptide has been identified as a Src optimal peptide substrate. It may be used to measure the wild type Src activity in comparison with other family members.
Sequence:AEEEIYGEFEAKKKK
MW:1799 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (103010-290)

Supplier: Anaspec Inc

Description: The SensoLyte® Plus 520 MMP-9 Assay Kit is designed for specifically detecting MMP-9 activity in biological samples which may contain multiple MMPs, such as culture medium, serum, plasma, synovial fluid, and tissue homogenate. A specific anti-MMP-9 monoclonal antibody is used in combination with a MMP fluorogenic substrate, 5-FAM/QXL®520 FRET peptide. The fluorescence signal is monitored at Ex/Em=490 nm/520 nm upon MMP-9-induced cleavage of the FRET substrate. Ample materials are provided to perform 96 assays in a 96-well format.

Catalog Number: (103010-284)

Supplier: Anaspec Inc

Description: Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated zinc endopeptidases capable of digesting extracellular matrix components. MMP-8 (neutrophil collagenase) is synthesized by neutrophils and stored in the specific granules until it is secreted.

Human MMP-8 is a full length pro-enzyme isolated from stimulated human neutrophil granulocytes. Proenzyme can be activated by incubating with 1 mM APMA at 37°C for 1 hr. Its activity can be measured in FRET-based enzymatic assays. 10-20 ng of enzyme is sufficient for FRET-based assay.

Catalog Number: (103003-410)

Supplier: Anaspec Inc

Description: Glucagon is a peptide hormone secreted from the pancreatic Islet of Langerhans alpha-cells, in response to low circulating blood glucose levels in order to restore normal glucose levels. It acts on hepatic enzymes that regulate glucose production and glycogen synthesis. Excessive amounts of circulating glucagon levels is implicated in the metabolic dysregulation of type 2 diabetes, since such conditions result in hyperglycemia.
Sequence: HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
MW: 3482.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (103010-670)

Supplier: Anaspec Inc

Description: Tobacco Etch Virus (TEV) proteinase is widely used to remove fusion tags from recombinant proteins