You Searched For: 2,3-Dichlorothiophenol


74,255  results were found

SearchResultCount:"74255"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: Sequence: Fmoc-D-Asp(OtBu)-OH

Supplier: Thermo Scientific Chemicals
Supplier: Thermo Scientific Chemicals
Description: N-Fmoc-L-valine 98%
Supplier: TCI America
Description: CAS Number: 84624-17-9
MDL Number: MFCD00062953
Molecular Formula: C20H21NO4
Molecular Weight: 339.39
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 146
Specific rotation [a]20/D: 17 deg (C=1, DMF)

SDS

Supplier: Bachem Americas

Supplier: Bachem Americas

Supplier: Bachem Americas
Description: An inactive degradation product of hepcidin-25 found in human urine.

Supplier: Bachem Americas

Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (CA80051-938)
Supplier: MilliporeSigma
Description: A potent, reversible granzyme B and caspase-8 inhibitor.

Catalog Number: (CA71007-374)
Supplier: VWR
Description: Glycerine ≥99.5% ACS

Supplier: Bachem Americas

Supplier: Thermo Scientific Chemicals
Description: (S)-4-Benzyloxycarbonylamino-2-(Fmoc-amino)butyric acid a substituted fluorene compound for proteomics research. Also used in agrochemical, pharmaceutical and dyestuff field.
Catalog Number: (TCB1630-005G)
Supplier: TCI America
Description: CAS Number: 15260-10-3
MDL Number: MFCD00066062
Molecular Formula: C16H23NO5
Molecular Weight: 309.36
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 116
Specific rotation [a]20/D: 16.5 deg (C=1, MeOH)

SDS


Supplier: Thermo Scientific Chemicals
Supplier: Bachem Americas
Description: Hepcidin-24 is an excellent alternative to biotinylated or heavy isotope-labeled Hepcidin-25 used as internal reference in the determination of Hep-25 by mass spectrometry-based methods, e.g. in human serum or urine.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
705 - 720 of 74,255
no targeter for Bottom