Print…

You Searched For: Methyl+indole-4-carboxylate


9,520  results were found

Refine Results Sort by
SearchResultCount:"9520"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCC2897-5G

7-Chloro-1-ethyl-6-fluoro-4-oxo-1,4-dihydro-3-quinolinecarboxylic acid ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: 7-Chloro-1-ethyl-6-fluoro-1,4-dihydro-4-oxoquinoline-3-carboxylic Acid, CAS Number: 68077-26-9, Purity: 98.0%, Molecular Formula: C12H9ClFNO3, Molecular Weight: 269.66 g/mol, Physical Form: Solid, Size: 1G

SDS Certificates

Image Unavailable-TCP2390-1G

3-Phenyl-5-isoxazolecarboxylic acid ≥98.0% (by GC)

Supplier: TCI America
Description: 3-Phenylisoxazole-5-carboxylic Acid, Purity: >98.0%(GC), CAS Number: 14442-12-7, Molecular Formula: C10H7NO3, Molecular Weight: 189.17, Size: 5G

Image Unavailable-TCT3155-100MG

3-(Trifluoromethyl)picolinic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-(Trifluoromethyl)pyridine-2-carboxylic Acid, Purity: >98.0%(GC)(T), Cas number: 87407-12-3, MF: C7H4F3NO2, MW: 191.11, Synonyms: 3-(Trifluoromethyl)picolinic Acid, Appearance: White - Slightly pale yellow solid crystal powder, Size: 500MG

SDS

Image Unavailable-TCP0961-025G

4-Phenylbenzoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 92-92-2
MDL Number: MFCD00002553
Molecular Formula: C13H10O2
Molecular Weight: 198.22
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Color: White
Melting point (°C): 227

SDS Certificates

Product Image-BDH25643.400

Methyl ethyl ketone ≥99.5%, HiPerSolv CHROMANORM® for HPLC, VWR Chemicals BDH®

Catalog Number: (BDH25643.400)
Supplier: VWR International
Description: Methyl ethyl ketone ≥99.5%, HiPerSolv CHROMANORM® for HPLC, VWR Chemicals BDH®

SDS Certificates Environmentally Preferable


Image Unavailable-B-1925.0001BA

Fmoc-D-Tic-OH

Supplier: Bachem Americas
Description: Sequence: Fmoc-D-1,2,3,4-tetrahydroisoquinoline-3-carboxylic acid

Product Image-BDH7388-2

Bromocresol green-methyl red in alcohol analytical reagent, VWR Chemicals BDH®

Catalog Number: (BDH7388-2)
Supplier: VWR International
Description: Bromocresol green and methyl red in denatured alcohol (SDA-3A).

SDS Certificates


Image Unavailable-TCE1267-50MG

Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate ≥97.0% (by HPLC)

Catalog Number: (TCE1267-50MG)
Supplier: TCI America
Description: Ethyl (11bR)-4-Amino-2,6-bis(3,5-di-tert-butylphenyl)-4,5-dihydro-3H-cyclohepta[1,2-a:7,6-a']dinaphthalene-4-carboxylate, Purity: >97.0%(HPLC), CAS number: 1678540-23-2, MF: C54H63NO2, Molecular Weight: 758.1, Size: 50 MG
Image Unavailable-103009-388

Human Des-gamma-carboxylated Osteocalcin/Bone Gla Protein

Catalog Number: (103009-388)
Supplier: Anaspec Inc
Description: This peptide is des-gamma-carboxylated osteocalcin/bone Gla protein (BGP). Osteocalcin/BGP is the most abundant non-collagenous protein of the bone extracellular matrix and is secreted by osteoblasts. This des-gamma-carboxylated peptide serves as a substrate for vitamin K-dependent carboxylase, which modifies Glu17, Glu21, and Glu24 to Gla residues.
Sequence: YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV (Disulfide bridge:C23-29)
MW: 5797.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-CAAAH61458-06

3-Fluoropicolinic acid 98%

Supplier: Thermo Scientific Chemicals
Description: 3-Fluoropyridine-2-carboxylic acid, 98%

Certificates

Image Unavailable-TCC3143-25G

Z-Pyr-OH ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: N-Carbobenzoxy-L-pyroglutamic Acid, CAS Number: 32159-21-0, Purity: 98.0%, Molecular Formula: C13H13NO5, Molecular Weight: 263.25 g/mol, Synonyms: (S)-1-Cbz-5-oxopyrrolidine-2-carboxylic Acid, N-Cbz-L-pyroglutamic Acid, Z-Pyr-OH, Size: 5G

SDS

Image Unavailable-TCB3850-1G

3-Phenylbenzoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 716-76-7
MDL Number: MFCD00045846
Molecular Formula: C13H10O2
Molecular Weight: 198.22
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 166

SDS Certificates

Image Unavailable-TCB3735-25G

tert-Butyl-2,5-dihydro-1H-pyrrole-1-carboxylate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 73286-70-1
MDL Number: MFCD01863512
Molecular Formula: C9H15NO2
Molecular Weight: 169.22
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 75
Melting point (°C): 41
Flash Point (°C): 81

SDS Certificates

Image Unavailable-AAH34258-03

3-Chloro-5-(trifluoromethyl)picolinic acid 97%

Catalog Number: (AAH34258-03)
Supplier: Thermo Scientific Chemicals
Description: 3-Chloro-5-(trifluoromethyl)pyridine-2-carboxylic acid, Purity: 97%, Cas Number: 80194-68-9, Molecular Formula: C7H3ClF3NO2, Color: White to cream, Form: Solid, Synonyms: 3-Chloro-5-(trifluoromethyl)picolinic acid, Size: 1g

SDS Certificates


Image Unavailable-TCB4605-1G

3-Bromo-2-thenoic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: 3-Bromothiophene-2-carboxylic Acid, Purity: >98.0%(GC)(T), Cas no. 7311-64-0, Molecular formula: C5H3BrO2S, Form: Crystal- Powder, Colour: White - Very pale yellow, Size: 5G

SDS

Product Image-CA11006-194

PureCoat™ Amine and Carboxyl Plates, Corning®

Supplier: Corning
Description: Corning PureCoat™ amine (positively charged) and carboxyl (negatively charged) surfaces provide improved cell attachment, faster cell proliferation, and enhanced recovery post-thaw over standard TC surfaces.

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,169 - 1,184 of 9,520
no targeter for Bottom