You Searched For: H-Cys(pMeOBzl)-OH

Supplier: Bachem Americas

Description: PRL2915, Cpa-D-Cys-Pal-D-Trp-Lys-Tle-Cys-Nal-amide, highly potent human somatostatin subtype 2 receptor (hsst2) antagonist with a Ki of 12 nM. Ki values for the other subtypes were >1000 nM for hsst1, 100 ± 57 nM for hsst3, 895 nM for hsst4, and 520 nM for hsst5, respectively. No agonist activity was found when tested alone at concentrations up to 10 µM. In a rat pituitary growth hormone in vitro antagonist assay versus somatostatin-14 (1nM) the somatostatin octapeptide analog PRL2915 exhibited an IC₅₀ value of 1.8 nM.

Supplier: Thermo Scientific Chemicals

Description: (R)-Ethyl-2-amino-3-mercaptopropanoate hydrochloride ≥98%

Certificates

Catalog Number: (89367-420)

Supplier: Genetex

Description: Peroxiredoxin (Prx) is a growing peroxidase family, whose mammalian members have been known to connect with cell proliferation, differentiation, and apoptosis. Many isoforms (about 50 proteins), collected in accordance to the amino acid sequence homology, particularly amino-terminal region containing active site cysteine residue, and the thiolspecific antioxidant activity, distribute throughout all the kingdoms. Among them, mammalian Prx consists of 6 different members grouped into typical 2-Cys, atypical 2-Cys Prx, and 1-Cys Prx. Except Prx6 belonging to 1-Cys Prx subgroup, the other five 2-Cys Prx isotypes have the thioredoxin-dependent peroxidase (TPx) activity utilizing thioredoxin, thioredoxin reductase, and NADPH as a reducing system. Mammalian Prxs are 20-30 kilodalton in molecular size and vary in subcellular localization: Prx1, 2, and 6 in cytosol, Prx3 in mitochondria, Prx 4 in ER and secretion, Prx 5 showing complicated distribution including peroxisome, mitochondria and cytosol.

Catalog Number: (CA80602-584)

Supplier: MilliporeSigma

Description: Pam₃Cys-Ser-(Lys)₄

Certificates

Supplier: Bachem Americas

Description: Potential impurity of octreotide.

Catalog Number: (10097-718)

Supplier: Prosci

Description: The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.

Supplier: Bachem Americas

Description: Tertiapin (TPN), a potent inhibitor of the inward-rectifier K⁺ channels, blocked a G-protein-gated channel (GIRK1/4) and the ROMK1 channel with nanomolar affinities, however a closely related channel, IRK1, was insensitive to tertiapin. Thus, tertiapin will be a powerful ligand for purifying functional channels as well as for screening pharmaceutical agents against these channels.

Catalog Number: (10813-660)

Supplier: Prosci

Description: The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.

Catalog Number: (103007-636)

Supplier: Anaspec Inc

Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (103007-672)

Supplier: Anaspec Inc

Description: This is cysteine conjugated to LL-37 via a LC linker. This type of modified LL-37 can be used for KLH, BSA or OVA conjugation.
Sequence: C - LC - [LL-37, 37 aa]
MW: 4709.7 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Catalog Number: (103871-242)

Supplier: ACROBIOSYSTEMS INC MS

Description: Human IFN-alpha 1 Protein, His Tag, ACROBiosystems

Catalog Number: (10098-244)

Supplier: Prosci

Description: The MDC gene is one of several Cys-Cys (CC) cytokine genes which are clustered on the q arm of chromosome 16.

Catalog Number: (103010-360)

Supplier: Anaspec Inc

Description: HiLyte™ Fluor 647 acid, SE (Ex/Em=647 nm/ 679 nm) is an excellent fluorescent labeling dye that generates the protein conjugates that are slightly red-shifted compared to those of Cy® 5 dyes, resulting in an optimal match to filters designed for Cy®5 dyes

Catalog Number: (H-7675.0005BA)

Supplier: Bachem Americas

Description: DDAVP, as the first vasopressin analog with a very high and very specific antidiuretic effect, has been widely used for different therapeutic purposes. The peptide also improves human learning and memory processes.
Synonym: DDAVP, Desmopressin
Sequence: 3-Mercaptopropionyl-Tyr-Phe-Gln-Asn-Cys-Pro-D-Arg-Gly-NH2
Salt: Acetate
Bonds: (Disulfide bond)

Supplier: Bachem Americas

Description: Efficient fluorogenic substrate for two matrix metalloproteinases: interstitial collagenase (MMP-1) and gelatinase (MMP-9). Dnp-Pro-Cha-Gly-Cys(Me)-His-Ala-Lys(N-Me-Abz)-amide has favorable solubility characteristics. Both enzymes cleave this substrate between Gly and Cys(Me) (Smc), liberating a cleavage product with a fluorescence signal suitable for inhibitor screening and determining Ki values. The major advantage of this FRET substrate is its adaptability to filters commonly available on commercial plate readers (excitation at 365 nm and emission at 450 nm).

Catalog Number: (10001-922)

Supplier: Biotium

Description: Llama anti-rabbit CF™ dye conjugates are prepared by labeling affinity purified llama anti-rabbit IgG (H+L) with a selection of CF™ dyes. CF™ dyes offer combined advantages in brightness, photostability, and specificity compared other fluorescent dyes. CF™640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CF™640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CF™640R is its exceptional photostability.

Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.