You Searched For: Fmoc-N-Me-Lys(boc)-OH


11,401  results were found

SearchResultCount:"11401"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Scientific Chemicals
Description: (S)-1-(tert-Butoxycarbonyl)piperidine-2-carboxylic acid ≥98%
Catalog Number: (H-7316.0500BA)
Supplier: Bachem Americas
Description: The protein dermcidin expressed in the sweat glands is secreted into the sweat and transported to the epidermal surface. The concomitant processing of the protein yields a broad-spectrum antimicrobial 47 amino acid peptide, dermcidin-1 (DCD-1).


Supplier: Bachem Americas
Description: FITC-YVADAPK(Dnp) is a specific FRET substrate for the determination of caspase-1 and caspase-1 like enzyme activities. Cleavage of FITC-YVADAPK(Dnp) at the P1 Asp residue results in a continuous fluorescent assay. It is useful both in FACS and fluorescence microscopy experiments. Caspase-3 is only weakly active using this substrate. See also our reference substance M-2280.

Catalog Number: (CAAAAL19802-03)
Supplier: Thermo Scientific Chemicals
Description: 3-(Boc-amino)-3-phenylpropionic acid 97%


Supplier: Thermo Scientific Chemicals
Description: N-Boc-D-threonine, 95%
Supplier: TCI America
Description: CAS Number: 133174-15-9
MDL Number: MFCD00151943
Molecular Formula: C21H23N3O5
Molecular Weight: 397.43
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: -10 deg (C=1, DMF)

SDS

Catalog Number: (A-2575.0005BA)
Supplier: Bachem Americas
Description: Sequence: Boc-D-2-Nal-OH


Supplier: Bachem Americas
Description: Sequence: Boc-Glu(OcHex)-OH

Catalog Number: (TCB1640-5G)
Supplier: TCI America
Description: CAS Number: 3978-80-1
MDL Number: MFCD00037179
Molecular Formula: C14H19NO5
Molecular Weight: 281.31
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 135
Specific rotation [a]20/D: 3 deg (C=2, AcOH)


Supplier: Thermo Scientific Chemicals
Description: N-Boc-3-(2-pyridyl)-L-alanine, 98%
Supplier: Bachem Americas
Description: For Boc-dipeptides Boc-Xaa-Gly-OH and Boc-Xaa-Pro-OH, which can be used as building blocks during Boc-SPPS, please see the product family 'Boc-Dipeptide Building Blocks' in the 'Amino Acid Derivatives' section. This family also includes short protected peptide fragments suitable for solution synthesis and preparation of enzyme substrates and inhibitors.

Supplier: Bachem Americas
Description: Sequence: Boc-Glu(OBzl)-OH

Supplier: Bachem Americas
Description: Sequence: Boc-cis-4-fluoro-Pro-OH

Catalog Number: (102996-536)
Supplier: Anaspec Inc
Description: β-Endorphin is an endogenous opioid neuropeptide found in the neurons of both the central and peripheral nervous system.
Sequence:YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
MW:3465.1 Da
% peak area by HPLC:95
Storage condition:-20° C


Supplier: Bachem Americas
Description: Sequence: Boc-Orn(Z)-OH

Supplier: TCI America
Description: CAS Number: 112883-39-3
MDL Number: MFCD00077050
Molecular Formula: C23H25NO6
Molecular Weight: 411.45
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 149
Specific rotation [a]20/D: 25 deg (C=1, DMF)

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
897 - 912 of 11,401
no targeter for Bottom