Print…

You Searched For: 3-Methylbenzofuran-2-carboxylic+acid


66,006  results were found

Refine Results Sort by
SearchResultCount:"66006"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-10423-844

Anti-PRODH Rabbit Polyclonal Antibody (Cy7®)

Catalog Number: (10423-844)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-10424-184

Anti-PRODH Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10424-184)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-103001-712

Human Recombinant alpha-Synuclein (from E. coli), Biotin

Catalog Number: (103001-712)
Supplier: Anaspec Inc
Description: The recombinant human α-synuclein (1-140) (GenBank Accession # NP_000336) was expressed and purified from E. coli and conjugated with biotin. Recombinant protein is produced without an affinity tag.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.

Certificates


Image Unavailable-76078-584

Anti-PRODH Rabbit Polyclonal Antibody (Alexa Fluor® 750)

Catalog Number: (76078-584)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Image Unavailable-76078-582

Anti-PRODH Rabbit Polyclonal Antibody (Alexa Fluor® 680)

Catalog Number: (76078-582)
Supplier: Bioss
Description: Proline oxidase catalyzes the conversion of proline to pyrroline-5-carboxylate, or P5C during the degradation of the amino acid Proline. Defects in PRODH are the cause of hyperprolinemia type 1, a disorder characterized by elevated serum proline levels. Defective PRODH may be involved in the psychiatric and behavioral phenotypes associated with the 22q11 velocardiofacial and DiGeorge syndrome and may be associated with susceptibility to schizophrenia 4 (SCZD4).
Product Image-76333-144

Empore™ Solid Phase Extraction Disks, CDS Analytical

Supplier: CDS ANALYTICAL
Description: Empore SPE disks are a cost-effective and trusted solution in large-volume sample processing for more than 30 years.

Image Unavailable-103009-742

Tau Peptide (306-336) (Repeat 3 Domain)

Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-10092-588

Anti-PON1 Rabbit Polyclonal Antibody

Catalog Number: (10092-588)
Supplier: Proteintech
Description: PON1, also named as PON and K-45, belongs to the paraoxonase family. PON1 hydrolyzes the toxic metabolites of a variety of organophosphorus insecticides. It can capable of hydrolyzing a broad spectrum of organophosphate substrates and a number of aromatic carboxylic acid esters. PON1 may mediate an enzymatic protection of low density lipoproteins against oxidative modification and the consequent series of events leading to atheroma formation. For glycosylated, the MW of PON1 is migrated 42-45kd. 55kd is a dimmer of isoform CRA-b. The antibody has crss-reaction to PON2 and PON3.
Product Image-10090-028

Anti-MCCC2 Rabbit Polyclonal Antibody

Catalog Number: (10090-028)
Supplier: Proteintech
Description: MCCC2(Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial) is also named as MCCB and belongs to the AccD/PCCB family. The putative 563-amino acid polypeptide has a calculated molecular mass of 61 kD and contains an N-terminal mitochondrial targeting sequence. It catalyzes carboxylation of 3 methylcrotonyl COA to form 3 methylglutaconyl-COA and is probably a dodecamer composed of six biotin-containing alpha subunits and six beta subunits. Defects in MCCC2 are the cause of methylcrotonoyl-CoA carboxylase 2 deficiency (MCC2D).
Image Unavailable-103007-254

Bacterial Sortase Substrate I

Catalog Number: (103007-254)
Supplier: Anaspec Inc
Description: This 5-amino acid peptide is a sortase substrate, C-terminal sorting signal. Sortase cleaves surface proteins at the LPXTG motif and catalyzes the formation of an amide bond between the carboxyl group of threonine and the amino group of cell-wall crossbridges. Sortases are a family of Gram-positive transpeptidases responsible for anchoring surface protein virulence factors to the peptidoglycan cell wall layer. Cleavage of this FRET substrate by sortase reveals the fluorescent signal, Abs/Em = 340/490 nm.
Sequence:DABCYL-LPETG-EDANS
MW:1015.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-746

Tau Peptide (337-368) (Repeat 4 Domain)

Catalog Number: (103009-746)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (337-368) is a 32-amino acid long peptide derived from the Repeat 4 domain.
Sequence:VEVKSEKLDFKDRVQSKIGSLDNITHVPGGGN
MW:3467.86 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103001-642

EndoClear™ Human Recombinant alpha-Synuclein (from E. coli)

Supplier: Anaspec Inc
Description: Full-length Recombinant human alpha-synuclein (GenBank Accession # NP_000336) was expressed in E. coli., and purified from bacterial lysate using proprietary method. Endotoxin was further removed by proprietary technique.
α-Synuclein is a major component of Lewy bodies in the affected neurons in Parkinson's disease. This protein has a mass of 14.5 kDa (140 amino acids long) and consists of a conserved degenerative amino-terminal domain and an acidic carboxyl-terminal with higher sequence divergence. α-Synuclein is predominantly expressed in brain, specifically in cerebellum, thalamus, neocortex, hippocampus, and striatum regions. Other tissues express α-Synuclein at very low levels. The physiological role of α-synuclein is not yet well understood. However, the presence of imperfect KTKEGV lipid interacting repeats suggests that it may be involved in synaptic vesicle homeostasis.

Product Image-10751-600

Anti-VKORC1 Rabbit Polyclonal Antibody

Catalog Number: (10751-600)
Supplier: Prosci
Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.
Product Image-CA95046-446

Anti-GS28 Mouse Monoclonal Antibody

Supplier: Enzo Life Sciences
Description: Golgi SNARE of 28 kDa (GS28), also known as p28 or GOS28, is a 28 kDa integral membrane protein on the surface of the Golgi apparatus that serves as a t-SNARE in ER to Golgi transport. The amino-terminal of GS28 is exposed to the cytosol and is anchored to the cis Golgi via a 20 amino acid carboxyl-terminal hydrophobic tail. GS28 co-immunoprecipitates complexes consisting of Syntaxin 5, Rbet1, Membrin, Rsec22, and Rsly1, and is therefore implicated in ER to-Golgi or intra-Golgi vesicle transport.

Image Unavailable-76219-588

Methyl (R)-(+)-3-boc-2,2-dimethyl-4-oxazolidinecarboxylate ≥96.0% (by GC)

Supplier: TCI America
Description: (R)-(+)-3-(tert-Butoxycarbonyl)-4-methoxycarbonyl-2,2-dimethyl-1,3-oxazolidine, >96%, CAS: 95715-86-9, MF: C12H21NO5, MW: 259.30, Synonyms: (R)-(+)-3-Boc-4-methoxycarbonyl-2,2-dimethyl-1,3-oxazolidine, Size: 1G

Image Unavailable-CAAAJ61491-03

Amphotericin B

Supplier: Thermo Scientific Chemicals
Description: Amphotericin B, antifungal activity has been used against leishmaniasis caused by protozoan parasites of the Leishmania genus.

Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,089 - 1,104 of 66,006
no targeter for Bottom