Print…

You Searched For: 3-Methylbenzofuran-2-carboxylic+acid


66,006  results were found

Refine Results Sort by
SearchResultCount:"66006"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103009-742

Tau Peptide (306-336) (Repeat 3 Domain)

Catalog Number: (103009-742)
Supplier: Anaspec Inc
Description: TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
MW:3248.51 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-10091-912

Anti-PCCA Rabbit Polyclonal Antibody

Catalog Number: (10091-912)
Supplier: Proteintech
Description: Propionyl-CoA carboxylase (PCC) catalyzes the biotin-dependent carboxylation of propionyl-CoA to D-methyl-malonyl CoA, a reaction that occurs in the mitochondrial matrix. PCC is involved in the catabolism of several essential amino acids (methionine, isoleucine, threonine and valine), as well as odd chain fatty acids and cholesterol. Deficiency of PCC results in propionic acidemia, a metabolic disorder characterized by severe metabolic ketoacidosis, vomiting, lethargy and hypotonia. PCC consists of nonidentical subunits (α and β) encoded by different genes (PCCA and PCCB, respectively). The αPCC cDNA contains an open reading frame of 2106 nucleotide bases and codes for a 702 amino acid polypeptide. The mature length subunit is 70 kDa and contains the biotin binding site.. This protein has 3 isoforms produced by alternative splicing with the molecular weight of 80 kDa, 77 kDa and 75 kDa. The full length protein has a transit peptide with 52 amino acids. This antibody is specific to PCCA.
Product Image-CA95046-448

Anti-GS28 Mouse Monoclonal Antibody

Supplier: Enzo Life Sciences
Description: Golgi SNARE of 28 kDa (GS28), also known as p28 or GOS28, is a 28 kDa integral membrane protein on the surface of the Golgi apparatus that serves as a t-SNARE in ER to Golgi transport. The amino-terminal of GS28 is exposed to the cytosol and is anchored to the cis Golgi via a 20 amino acid carboxyl-terminal hydrophobic tail. GS28 co-immunoprecipitates complexes consisting of Syntaxin 5, Rbet1, Membrin, Rsec22, and Rsly1, and is therefore implicated in ER to-Golgi or intra-Golgi vesicle transport.

Image Unavailable-76219-588

Methyl (R)-(+)-3-boc-2,2-dimethyl-4-oxazolidinecarboxylate ≥96.0% (by GC)

Supplier: TCI America
Description: (R)-(+)-3-(tert-Butoxycarbonyl)-4-methoxycarbonyl-2,2-dimethyl-1,3-oxazolidine, >96%, CAS: 95715-86-9, MF: C12H21NO5, MW: 259.30, Synonyms: (R)-(+)-3-Boc-4-methoxycarbonyl-2,2-dimethyl-1,3-oxazolidine, Size: 1G

Product Image-CAPI22360

SMCC (N-Succinimidyl 4-(N-Maleimidomethyl)cyclohexanecarboxylate), Pierce™

Catalog Number: (CAPI22360)
Supplier: Thermo Scientific
Description: Thermo Scientific Pierce SMCC is a hetero-bifunctional crosslinker that contain N-hydroxysuccinimide (NHS) ester and maleimide groups that allow covalent conjugation of amine- and sulfhydryl-containing molecules. NHS esters react with primary amines at pH 7–9 to form amide bonds, while maleimides react with sulfhydryl groups at pH 6.5–7.5 to form stable thioether bonds. In aqueous solutions, NHS ester hydrolytic degradation is a competing reaction whose rate increases with pH. The maleimide group is more stable than the NHS-ester group, but will slowly hydrolyze and lose its reaction specificity for sulfhydryls at pH values > 7.5. For these reasons, conjugations with these crosslinkers are usually performed at pH 7.2–7.5, with the NHS ester (amine-targeted) reacted before or simultaneous with the maleimide (sulfhydryl-targeted) reaction.

SDS Certificates


Product Image-10751-600

Anti-VKORC1 Rabbit Polyclonal Antibody

Catalog Number: (10751-600)
Supplier: Prosci
Description: VKORC1 Antibody: Vitamin K epoxide reductase complex subunit 1 (VKORC1) is the enzyme that is responsible for reducing vitamin K 2,3-epoxide to the enzymatically activated form which is essential for blood clotting. This enzymatically activated form of vitamin K is a reduced form required for the carboxylation of glutamic acid residues in some blood-clotting proteins. Fatal bleeding can be caused by vitamin K deficiency and by the vitamin K antagonist warfarin, and it is VKORC1 that is sensitive to warfarin. In humans, mutations in this gene can be associated with deficiencies in vitamin-K-dependent clotting factors and, in humans and rats, with warfarin resistance.
Image Unavailable-10781-204

Human Recombinant CDNF (from E. coli)

Supplier: Peprotech
Description: CDNF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine-specific neurons. CDNF and its structural homolog, MANF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. CDNF and MANF can prevent 6-OHDA-induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson’s disease. Recombinant Human CDNF is an 18.5 kDa protein consisting of 162 amino acids, including 8 cysteine residues.

Image Unavailable-TCE1068-1G

Ethyl-4,6-dichloronicotinate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 40296-46-6
MDL Number: MFCD00173839
Molecular Formula: C8H7Cl2NO2
Molecular Weight: 220.05
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 85
Melting point (°C): 33

SDS Certificates

Image Unavailable-89359-522

Anti-RPS6 Rabbit Polyclonal Antibody

Catalog Number: (89359-522)
Supplier: Genetex
Description: 40S ribosomal protein S6 (also known as RPS6) is a ~31 kDa substrate of p70 S6 kinase (p70S6K) and a major component of translational machinery involved in protein synthesis, cell growth, proliferation, and metabolism. RPS6 undergoes phosphorylation on multiple serines in the carboxyl terminal region in the order 236-->235-->240-->244-->247, due to the positions of these amino acid residues on the alpha-helix. Hyperphosphorylation of RPS6 stimulates protein synthesis that mediates progression through the cell cycle.
Image Unavailable-10096-832

Anti-USP1 Rabbit Polyclonal Antibody

Catalog Number: (10096-832)
Supplier: Proteintech
Description: USP1(Ubiquitin carboxyl-terminal hydrolase 1) is a negative regulator of DNA damage repair which specifically deubiquitinates monoubiquitinated FANCD2.It is Also involved in PCNA-mediated translesion synthesis (TLS) by deubiquitinating monoubiquitinated PCNA.This protein, which consists of 785 amino acids with a deduced molecular mass of 88.2 kDa, possesses His and Cys domains that are highly conserved in all members of the ubiquitin-specific processing (UBP) family of proteases. The USP1 enzyme can undergo autocleavage, resulting in a 100 kDa N-terminal fragment and a 14 kDa C-terminal fragment.
Image Unavailable-TCM2723-1G

Methyl-1-boc-3-pyrrolidinecarboxylate ≥98.0% (by GC)

Supplier: TCI America
Description: Methyl 1-(tert-Butoxycarbonyl)-3-pyrrolidinecarboxylate, Purity: >98.0%(GC), CAS Number: 122684-33-7, MF: C11H19NO4, MW: 229.28, Synonyms: 1-Boc-3-pyrrolidinecarboxylic Acid Methyl Ester, Form: Clear, Color: Colorless - Yellow, Size: 5G

SDS

Image Unavailable-10073-036

Human Recombinant MANF (from E. coli)

Catalog Number: (10073-036)
Supplier: Prosci
Description: MANF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine specific neurons. MANF and its structural homolog CDNF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. MANF and CDNF can prevent 6-OHDA induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson disease. Recombinant human MANF is an 18.1 kDa protein consisting of 158 amino acids including 8 cysteine residues.
Image Unavailable-10073-016

Human Recombinant Cdnf (from E. coli)

Catalog Number: (10073-016)
Supplier: Prosci
Description: CDNF is a secreted neurotrophic factor that is expressed in brain, neuronal and certain non-neuronal tissues. It has been shown to promote survival, growth and function of dopamine specific neurons. CDNF and its structural homolog MANF, each contain an N-terminal saposin-like lipid binding domain, and a carboxyl-terminal domain, which is not homologous to previously characterized protein structures. CDNF and MANF can prevent 6-OHDA induced degeneration of dopaminergic neurons by triggering survival pathways in a rat experimental model of Parkinson disease. Recombinant human CDNF is an 18.5 kDa protein consisting of 162 amino acids including 8 cysteine residues.
Image Unavailable-10781-372

Staphylococcus Recombinant Glu-C (from E. coli)

Supplier: Peprotech
Description: Proteases (also called Proteolytic Enzymes, Peptidases, or Proteinases) are enzymes that hydrolyze the amide bonds within proteins or peptides. Most proteases act in a specific manner, hydrolyzing bonds at, or adjacent to, specific residues, or a specific sequence of residues contained within the substrate protein or peptide. Proteases play an important role in most diseases and biological processes, including prenatal and postnatal development, reproduction, signal transduction, immune response, various autoimmune and degenerative diseases, and cancer. They are also an important research tool, as they are frequently used in the analysis and production of proteins. Glu-C cleaves at the Carboxyl side of E (can also cleave D under certain conditions). Recombinant Staphylococcus Glu-C is a 28.8 kDa protease consisting of 266 amino acid residues.

Image Unavailable-CAAAB21672-18

N-Carbobenzoxy-L-proline ≥98%

Supplier: Thermo Scientific Chemicals
Description: N-Carbobenzoxy-L-proline ≥98%

Certificates

Image Unavailable-TCE0954-25G

1-Boc-DL-nipecotic acid ethyl ester ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 130250-54-3
MDL Number: MFCD04116274
Molecular Formula: C13H23NO4
Molecular Weight: 257.33
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 93
Melting point (°C): 37

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,105 - 1,120 of 66,006
no targeter for Bottom