Print…

You Searched For: 3,4-Dimethoxybenzoic+acid


68,885  results were found

Refine Results Sort by
SearchResultCount:"68885"

Sort Results

List View Easy View

Rate These Search Results

Product Image-470310-652

TPX Beakers

Catalog Number: (470310-652)
Supplier: Wards
Description: These TPX (PMP) beakers are idea for general laboraotry use.
Image Unavailable-TCD2722-25G

2,5-Dichloro-4-nitroaniline ≥98.0%

Supplier: TCI America
Description: CAS Number: 6627-34-5
MDL Number: MFCD00025157
Molecular Formula: C6H4Cl2N2O2
Molecular Weight: 207.01
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 155

SDS Certificates

Image Unavailable-TCQ0008-100G

Quinhydrone

Catalog Number: (TCQ0008-100G)
Supplier: TCI America
Description: CAS Number: 106-34-3
MDL Number: MFCD00010310
Molecular Formula: C12H10O4
Molecular Weight: 218.21
Form: Crystal
Color: Yellow
Melting point (°C): 172

SDS Certificates


Product Image-ABCA_AB316284-1MG

Anti-Hepatitis B Virus Core Antigen Rabbit Monoclonal Antibody [clone: EPR28251-34]

Supplier: Abcam
Description: Rabbit monoclonal [EPR28251-34] to Hepatitis B Virus Core Antigen - BSA and Azide free.

New Product

Product Image-ABCA_AB195883-100U

Anti-Tubulin 0 Monoclonal Antibody [clone: YOL1/34] (Alexa Fluor® 488)

Catalog Number: (ABCA_AB195883-100U)
Supplier: Abcam
Description: Alexa Fluor® 488 Rat monoclonal [YOL1/34] to Tubulin - Microtubule Marker.

New Product


Product Image-14224-406

VWR® Talon® Stainless Steel Fume Hood Lab-Frame Kits

Supplier: VWR International
Description: Choose from four kits specifically designed to fit within laboratory fume hoods.

Product available on GSA Advantage®

Image Unavailable-ABCA_AB308959-200U

Anti-Amyloid Precursor Protein Rabbit Monoclonal Antibody [clone: EPR5118-34] (Alkaline Phosphatase)

Catalog Number: (ABCA_AB308959-200U)
Supplier: Abcam
Description: Alkaline Phosphatase Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Image Unavailable-CA80050-106

Adenosine-5'-diphosphate monosodium salt

Supplier: MilliporeSigma
Description: Adenosine-5'-diphosphate monosodium salt

SDS Certificates

Image Unavailable-CAAA36731-A3

Calcium phosphate tribasic (34 - 40% Ca)

Supplier: Thermo Scientific Chemicals
Description: Calcium phosphate tribasic (34 - 40% Ca)

Certificates

Image Unavailable-77122-260

Anti-H2-D1 Mouse Monoclonal Antibody [clone: [34-5-8S]]

Catalog Number: (77122-260)
Supplier: Prosci
Description: Anti-H2-D1 Mouse Monoclonal Antibody [clone: [34-5-8S]]
Image Unavailable-TCD4822-1G

4,6-Dibromodibenzothiophene ≥98.0% (by GC)

Supplier: TCI America
Description: 4,6-Dibromodibenzothiophene, Purity: >98.0%(GC), CAS Number: 669773-34-6, Molecular Formula: C12H6Br2S, Molecular Weight: 342.05, Form: Crystal-Powder, Solid, Color: White - Almost white, Size: 200MG

SDS

Image Unavailable-ABCA_AB312245-100U

Anti-Amyloid Precursor Protein Rabbit Monoclonal Antibody [clone: EPR5118-34] (Alexa Fluor® 555)

Catalog Number: (ABCA_AB312245-100U)
Supplier: Abcam
Description: Alexa Fluor® 555 Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Image Unavailable-ABCA_AB174603-100U

Anti-Mouse MHC Class I H 2Dd Mouse Monoclonal Antibody [clone: 34-1-2S]

Catalog Number: (ABCA_AB174603-100U)
Supplier: Abcam
Description: Mouse monoclonal [34-1-2S] to Mouse MHC Class I H 2Dd - Low endotoxin, Azide free.

New Product


Image Unavailable-76220-116

1-(2-Hydroxyethyl)-3-methylimidazolium chloride ≥98.0% (by HPLC)

Supplier: TCI America
Description: 1-(2-Hydroxyethyl)-3-methylimidazolium Chloride, Purity: >98.0%(HPLC), CAS number: 61755-34-8, Molecular Formula: C6H11ClN2O, Molecular Weight: 162.62, Form: Crystal - Powder, White - Pale yellow, Size: 5G

Image Unavailable-102996-094

Human Parathyroid Hormone (1-34)

Catalog Number: (102996-094)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF
MW: 4117.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-TCD0311-025G

3',4'-Dichloroacetophenone ≥98.0%

Catalog Number: (TCD0311-025G)
Supplier: TCI America
Description: CAS Number: 2642-63-9
MDL Number: MFCD00000553
Molecular Formula: C8H6Cl2O
Molecular Weight: 189.04
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 121
Melting point (°C): 72
Flash Point (°C): 110

SDS


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,233 - 1,248 of 68,885
no targeter for Bottom