You Searched For: 3,4-Dimethoxyaniline


4,492  results were found

SearchResultCount:"4492"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Chemglass
Description: Cylindrical shaped drying tower has a 34/28 ground glass stopper.

Small Business Enterprise

Supplier: TCI America
Description: CAS Number: 446-34-4
MDL Number: MFCD00007053
Molecular Formula: C7H6FNO2
Molecular Weight: 155.13
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 98
Melting point (°C): 54
Flash Point (°C): 110

SDS

Catalog Number: (75834-694)
Supplier: Restek
Description: Standard Surrogate (3,4-Dinitrotoluene) 8095, CAS no: 610-39-9, Concentration: 1,000 ug/mL in methanol, Shelf Life: 6 Months, Storage: 10 deg C or colder, Volume: 1 mL/ampule


Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Thermo Scientific Chemicals
Description: Colorimetric determination of amino acids and amines.
Catalog Number: (TCD1878-100G)
Supplier: TCI America
Description: CAS Number: 1131-62-0
MDL Number: MFCD00008737
Molecular Formula: C10H12O3
Molecular Weight: 180.20
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 161
Melting point (°C): 49
Flash Point (°C): 110

Supplier: TCI America
Description: 4'-Hydroxyacetophenone Oxime, Purity: >98.0%(GC), CAS Number: 34523-34-7, Molecular Formula: C8H9NO2, Molecular Weight: 151.17, Physical state: Solid, Form: Crystal - Powder, Colour: White - Pale yellow, Size: 5G

SDS

Supplier: TCI America
Description: CAS Number: 7343-34-2
MDL Number: MFCD00656686
Molecular Formula: C4H7N3
Molecular Weight: 97.12
Purity/Analysis Method: >95.0% (GC,T)
Form: Crystal
Boiling point (°C): 260
Melting point (°C): 140
Supplier: Abcam
Description: Anti-RIM1 Rabbit Monoclonal Antibody [clone: EPR29131-34]

New Product

Supplier: TCI America
Description: CAS Number: 4489-34-3
MDL Number: MFCD00672147
Molecular Formula: C5H4Cl2N2O2S
Molecular Weight: 227.06
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 120
Supplier: TCI America
Description: CAS Number: 611-34-7 MDL Number: MFCD00006797 Molecular Formula: C9H8N2 Molecular Weight: 144.18 Purity/Analysis Method: <gt/>99.0% (T) Form: Crystal Boiling point (°C): 310 Melting point (°C): 109
Supplier: Abcam
Description: Rabbit monoclonal [EPR19089-34] to MEF2A + MEF2C.

New Product

Catalog Number: (89152-554)
Supplier: Enzo Life Sciences
Description: AMPA receptor activator


Supplier: TCI America
Description: 3',4'-Dihydroxyflavone, Purity: >97.0%(T), CAS Number: 4143-64-0, Molecular Formula: C15H10O4, Molecular Weight: 254.24, Size: 200MG

Catalog Number: (CAAAA17257-06)
Supplier: Thermo Scientific Chemicals
Description: 3',4'-Difluoropropiophenone 97%

Supplier: Abcam
Description: Rabbit monoclonal [EPR26957-34] to TRIM46.

New Product

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
737 - 752 of 4,492
no targeter for Bottom