Print…

You Searched For: 3,4-Difluorobenzaldehyde


4,475  results were found

Refine Results Sort by
SearchResultCount:"4475"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCT0095-100G

Tetraethylammonium chloride ≥98.0% (by titrimetric analysis)

Catalog Number: (TCT0095-100G)
Supplier: TCI America
Description: CAS Number: 56-34-8
MDL Number: MFCD00011828
Molecular Formula: C8H20ClN
Molecular Weight: 165.71
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White

SDS Certificates


Image Unavailable-CA8.01847.0100

Butyl vinyl ether stabilized for synthesis, Sigma-Aldrich®

Supplier: MilliporeSigma
Description: Cas Number 111-34-2, Stabilised With 100 Ppm Koh For Synthesis

SDS

Image Unavailable-TCA2328-5G

9-Anthraceneboronic acid ≥98.0% (by HPLC) (contains varying amounts of Anhydride)

Supplier: TCI America
Description: CAS Number: 100622-34-2
MDL Number: MFCD03425925
Molecular Formula: C14H11BO2
Molecular Weight: 222.05
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 217

SDS Certificates

Image Unavailable-H-5964.0500BA

Human pTH (1-34) amide Trifluoroacetate

Catalog Number: (H-5964.0500BA)
Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).
Image Unavailable-TCD1878-100G

3',4'-Dimethoxyacetophenone ≥98.0%

Catalog Number: (TCD1878-100G)
Supplier: TCI America
Description: CAS Number: 1131-62-0
MDL Number: MFCD00008737
Molecular Formula: C10H12O3
Molecular Weight: 180.20
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 161
Melting point (°C): 49
Flash Point (°C): 110

SDS Certificates


Image Unavailable-TCM2479-1G

Moxifloxacin hydrochloride monohydrate ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: Moxifloxacin Hydrochloride Monohydrate, >98%, 192927-63-2, C21H24FN3O4.HCl.H2O, Synonym: 1-Cyclopropyl-6-fluoro-1,4-dihydro-8-methoxy-7-[(4aS,7aS)-octahydro-1H-pyrrolo[3,4-b]pyridin-6-yl]-4-oxo-3-quinolinecarboxylic Acid Hydrochloride Monohydrate, 100MG

Certificates

Image Unavailable-H-9115.0500BA

Bovine (D-Trp¹²,Tyr³⁴)-pTH (7-34) Amide Trifluoroacetate

Supplier: Bachem Americas
Description: See also the pTH2 receptor agonist TIP39 (H-4878).

Product Image-89152-554

Cyclothiazide

Catalog Number: (89152-554)
Supplier: Enzo Life Sciences
Description: AMPA receptor activator
Image Unavailable-102996-410

Human Parathyroid Hormone (1-34)-Lys(Biotin), Biotin

Catalog Number: (102996-410)
Supplier: Anaspec Inc
Description: Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1–34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia.
Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFK(Biotin)
MW: 4472.2 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Image Unavailable-TCC2832-5G

(S)-6-Chloro-4-hydroxy-3,4-dihydro-2H-thieno[3,2-e][1,2]thiazine-1,1-dioxide ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 160982-16-1
MDL Number: MFCD09033311
Molecular Formula: C6H6ClNO3S2
Molecular Weight: 239.69
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 130
Specific rotation [a]20/D: -5 deg (C=1, MeOH)

SDS

Product Image-89044-788

Accessories for Socorex™ Calibrex™ 521 digital Bottle Top Dispensers, DWK Life Sciences

Catalog Number: (89044-788)
Supplier: DWK Life Sciences (KIMBLE)
Description: threaded, 34 mm OD

Small Business Enterprise


Image Unavailable-TCC0872-25G

N-(2-Cyanoethyl)-N-methylaniline ≥98.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 94-34-8
MDL Number: MFCD00019856
Molecular Formula: C10H12N2
Molecular Weight: 160.22
Purity/Analysis Method: >98.0% (T)
Form: Clear Liquid
Boiling point (°C): 186
Flash Point (°C): 110
Specific Gravity (20/20): 1.05

SDS Certificates

Image Unavailable-ABCA_AB310715-100U

Anti-Amyloid Precursor Protein (Linkage-specific K63) Rabbit Monoclonal Antibody [clone: EPR5118-34] (Alexa Fluor® 594)

Catalog Number: (ABCA_AB310715-100U)
Supplier: Abcam
Description: Alexa Fluor® 594 Rabbit monoclonal [EPR5118-34] to Amyloid Precursor Protein.

New Product


Product Image-470300-678

Cellulose

Catalog Number: (470300-678)
Supplier: Ward's Science
Description: CAS Number: 9004-34-6
Formula Weight: (162.14)x
Formula: (C6H10O5)x
Density (g/mL): 0.2-0.5
Solubility: Insoluble in Water
Synonyms: Microcrystalline Cellulose
Shelf Life (months): 36
Storage: Green

SDS


Product Image-89148-020

PD 184,352 ≥95% (by HPLC, NMR)

Supplier: Enzo Life Sciences

Product Image-97061-444

D-(+)-Biotin, Reagent Grade

Supplier: VWR
Description: A small biomolecule, 244 Daltons, that has high binding affinity to avidin and streptavidin often used to label antibodies and enzymes. Several molecules of biotin can react with a single protein molecule to increase the sensitivity at the site of detection.

SDS Certificates

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
801 - 816 of 4,475
no targeter for Bottom