Print…

You Searched For: 3,3\\\',5,5\\\'-Tetramethylbenzidine+dihydrochloride+hydrate


12,214  results were found

Refine Results Sort by
SearchResultCount:"12214"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAH59169-14

5-tert-Butyl-N-[(9H-fluoren-9-ylmethoxy)carbonyl]-L-glutamate hydrate 98% (by HPLC)

Supplier: Thermo Scientific Chemicals

Certificates

Image Unavailable-10779-844

Human Recombinant IL-33 (from E. coli)

Supplier: Peprotech
Description: Human IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-κB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Human IL-33 is a 17.9 kDa protein containing 159 amino acid residues.

Image Unavailable-CAAA43345-02

Tris(4,4,4-trifluoro-1-(2-thienyl)-1,3-butanediono)europium(III) hydrate

Catalog Number: (CAAA43345-02)
Supplier: Thermo Scientific Chemicals
Description: Applications: laser dye
Soluble in methanol, toluene

Certificates


Image Unavailable-B-1615.0001BA

(2R,2'R)-3,3'-Disulfanediylbis(2-((((9H-fluoren-9-yl)methoxy)carbonyl)amino)propanoic acid)

Supplier: Bachem Americas
Description: Sequence: (Fmoc-Cys-OH)₂

Image Unavailable-102981-668

Human Recombinant IL-33 (from E. coli)

Supplier: Adipogen
Description: Interleukin-33 (IL-33; HF-NEV; IL-1F11), a member of the IL-1 family of cytokines, is expressed by many cell types following pro-inflammatory stimulation and is thought to be released upon cell lysis. IL33 binds to and signals through ST2 (IL1R1) and its stimulation recruits MYD88, IRAK, IRAK4, and TRAF6, followed by phosphorylation of ERK1(MAPK3)/ERK2(MAPK1), p38(MAPK14), and JNK. The ability of IL-33 to target numerous immune cell types, like Th2-like cells, mast cells, and B1 cells, and to induce cytokine and chemokine production underlines its potential in influencing the outcome of a wide range of diseases, such as arthritis, asthma, atopic allergy & anaphylaxis, cardiovascular disease/atherosclerosis, nervous system diseases, and sepsis.

Image Unavailable-CAAAA44614-02

(S)-(-)-2,2',6,6'-Tetramethoxy-4,4'-bis(di(3,5-xylyl)phosphino)-3,3'-bipyridine

Supplier: Thermo Scientific Chemicals
Description: Powder, packaged under argon

Certificates

Image Unavailable-10780-070

Mouse Recombinant IL-33 (from E. coli)

Supplier: Peprotech
Description: IL-33 is a proinflammatory protein that shares structural and functional characteristics with the IL-1 cytokine family. It binds and signals through the IL-1RL1/ST2 receptor, to activate NF-κB and MAP kinases. IL-33 induces production of TH2 cell related cytokines, including IL-4, IL-5 and IL-13, and exerts multiple inflammation related bioactivities. Recombinant Murine IL-33 is a 17.5 kDa protein containing 158 amino acid residues.

Image Unavailable-TCD0375-001G

2,6-Dichlorophenolindophenol sodium salt dihydrate ≥95.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 620-45-1
MDL Number: MFCD00150015
Molecular Formula: C12H7Cl2NO2
Molecular Weight: 290.07
Purity/Analysis Method: >95.0% (T)
Form: Crystal

SDS Certificates

Image Unavailable-103003-038

Human Beta-Amyloid (1-33)

Catalog Number: (103003-038)
Supplier: Anaspec Inc
Description: Purified metalloendopeptidase cleaves the Gly33-Leu34 bond of Alzheimer Aß (1-40) peptide producing soluble 1-33 and 34-40 fragments of Aß (1-40) without any neurotoxic effects.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIG
Molecular Weight: 3674 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-TCA0363-500G

1-Amino-8-naphthol-2,4-disulfonic acid monosodium salt hydrate ≥85.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 52789-62-5
MDL Number: MFCD00068275
Molecular Formula: C10H9NO7S2
Molecular Weight: 341.28
Purity/Analysis Method: >85.0% (HPLC,T)
Form: Crystal

Certificates

Image Unavailable-102980-350

Human Recombinant IL-33 (from E. coli)

Supplier: Adipogen
Description: Interleukin-33 (IL-33; HF-NEV; IL-1F11), a member of the IL-1 family of cytokines, is expressed by many cell types following pro-inflammatory stimulation and is thought to be released upon cell lysis. IL-33 binds to and signals through ST2 (IL-1R1) and its stimulation recruits MYD88, IRAK, IRAK4 and TRAF6, followed by phosphorylation of ERK1 (MAPK3) / ERK2 (MAPK1), p38 (MAPK14) and JNK. The ability of IL-33 to target numerous immune cell types, like Th2-like cells, mast cells and B1 cells, and to induce cytokine and chemokine production underlines its potential in influencing the outcome of a wide range of diseases, such as arthritis, asthma, atopic allergy & anaphylaxis, cardiovascular disease/atherosclerosis, nervous system diseases and sepsis. IL-33 facilitates Treg expansion in vitro and in vivo. Recently, IL-33 has been involved in adipocyte differentiation. The biological activity of IL-33 at its receptor ST2 is rapidly terminated in the extracellular environment by its oxidation (formation of two disulfide bridges), resulting in an extensive conformational change that disrupts the ST2 binding site. Mutations at amino acids C208S/C232S protect IL-33 from oxidation and increase its activity.

Image Unavailable-TCN1023-1G

Dimethylammonium dichlorotri(mu-chloro)bis{(R)-(+)-5,5'-bis[di(3,5-xylyl)phosphino]-4,4'-bi-1,3-benzodioxole}diruthenate(II)

Supplier: TCI America
Description: [NH2Me2][(RuCl((R)-dm-segphos*))2(u-Cl)3], CAS Number: 935449-46-0, MF: C94H96Cl5NO8P4Ru2, MW: 1871.09, Synonym: Dimethylammonium Dichlorotri(u-chloro)bis[(R)-(+)-5,5-bis[di(3,5-xylyl)phosphino]-4,4-bi-1,3-benzodioxole]diruthenate(II), Size: 200MG

SDS

Image Unavailable-CAAA18219-A1

Magnesium phosphate pentahydrate (33% P₂O₅)

Supplier: Thermo Scientific Chemicals
Description: Magnesium phosphate pentahydrate (33% P₂O₅)

Certificates

Image Unavailable-H-4444.1000BA

Human CART (55-102) Trifluoroacetate

Supplier: Bachem Americas
Description: CART (Cocaine- and Amphetamine-Regulated Transcript) is a recently discovered peptide, which was initially identified as mRNA produced primarily in the rat hypothalamus after administration of psychomotor stimulants. It is a satiety factor and closely associated with the actions of two important regulators of food intake, leptin and neuropeptide Y. When systemic leptin or receptors for leptin are inhibited, expression of CART mRNA is suppressed. CART (55-102) has been isolated from the hypothalamus of ovine suggesting in vivo processing at the Lys⁵³-Arg⁵⁴ region. When injected intracerebroventricularly into rats, recombinant CART peptides inhibited both normal and starvation-induced feeding, and completely blocked the feeding response induced by neuropeptide Y. Thus far, CART (55-102) appears to be the most potent fragment with a conserved secondary structure consisting of three disulfide bridges. Disruption of this secondary structure by reduction leads to a loss of the appetite induction.

Image Unavailable-103007-408

Human gp100 (25–33) peptide

Catalog Number: (103007-408)
Supplier: Anaspec Inc
Description: This is amino acids 25 to 33 fragment of human melanoma antigen gp100. This H-2Db restricted epitope is recognized by T cells. The gp100-specific, H-2Db-restricted, CD8+ T cells are capable of recognizing B16 melanoma but not normal melanocytes. This peptide was used as an immunogen in multiple cancer immunotherapy studies.
Sequence: KVPRNQDWL
MW: 1155.3 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-TCN1024-1G

Dimethylammonium dichlorotri(mu-chloro)bis{(S)-(-)-5,5'-bis[di(3,5-xylyl)phosphino]-4,4'-bi-1,3-benzodioxole}diruthenate(II)

Supplier: TCI America
Description: [NH2Me2][(RuCl((S)-dm-segphos*))2(u-Cl)3], CAS Number: 944451-14-3, MF: C94H96Cl5NO8P4Ru2, MW: 1871.09, Synonym: Dimethylammonium Dichlorotri(u-chloro)bis[(S)-(-)-5,5-bis[di(3,5-xylyl)phosphino]-4,4-bi-1,3-benzodioxole]diruthenate, Size: 200MG

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,041 - 1,056 of 12,214
no targeter for Bottom