You Searched For: 2,7-Diaminofluorene


3,744  results were found

SearchResultCount:"3744"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Biotium
Description: This antibody recognizes a 24-27 kDa estrogen-regulated protein, identified as heat shock protein 27 (hsp27). Hsp27 was recently found to be identical to the estrogen-induced p29 and 24K protein. About 50% of breast carcinomas are positive for hsp27 especially those that are also positive for estrogen and/or progesterone receptor. HSP27 has also been implicated in drug resistance in cancer cells.

Supplier: Sino Biological
Description: Recombinant human ABL1 (K290R) (27-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal His tag. ABL1 (K290R) is a kinase dead mutant.

New Product

Supplier: TCI America
Description: [Metal indicator and spectrophotometric reagent for transition metals]
CAS Number: 2246-46-0
MDL Number: MFCD00005322
Molecular Formula: C9H7N3O2S
Molecular Weight: 221.23
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 209

SDS

Catalog Number: (89279-090)
Supplier: Genetex
Description: Rabbit polyclonal to TCCR


Supplier: Anaspec Inc
Description: This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively.
Sequence: FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
MW: 4024.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (59432-276)
Supplier: Corning
Description: These PYREX® hollow borosilicate glass stoppers are light weight, strong to reduce chipping and breakage. Barrel shaped head makes it easy to clean and rotate in or out. Grooves in the sides help prevent slippage.

Catalog Number: (TCA1993-5G)
Supplier: TCI America
Description: CAS Number: 348-40-3
MDL Number: MFCD00013336
Molecular Formula: C7H5FN2S
Molecular Weight: 168.19
Purity/Analysis Method: >97.0% (HPLC,T)
Form: Crystal
Melting point (°C): 183

SDS


Supplier: DWK Life Sciences (KIMBLE)
Description: Funnel is supplied with a [ST] ground glass stopper and a PTFE stopcock

Catalog Number: (10339-930)
Supplier: Bioss
Description: Involved in platelet activation and aggregation. Regulates paranodal junction formation. Involved in cell adhesion, cell motility and tumor metastasis. Required for sperm-egg fusion.


Catalog Number: (89279-092)
Supplier: Genetex
Description: Rabbit polyclonal to TCCR


Supplier: MilliporeSigma
Description: MagniSolv™ deuterated solvents provide reliable results in the NMR-spectra with extremely low residual water, excellent chemical purity and the highest isotopic enrichment.
Catalog Number: (CAPI45208)
Supplier: Thermo Scientific
Description: The Melon Gel Spin Plate Kit for IgG Screening offers a high-throughput format for quick purification and screening of antibodies.

Supplier: Bachem Americas
Description: Ser-Tyr stimulated the uptake of deltorphin in SK-N-SH cells. The dipeptide forms a complex with Cu(II) acting as a tridentate ligand.

Catalog Number: (66025-530)
Supplier: Corning
Description: Flasks are for use with light sensitive materials.

Catalog Number: (89025-816)
Supplier: Hirschmann
Description: Flasks feature a fine white graduation line and marking spot


Catalog Number: (89025-762)
Supplier: Hirschmann
Description: Flasks feature a fine white graduation line and marking spot


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,025 - 1,040 of 3,744
no targeter for Bottom