Print…

You Searched For: 2,2\'-Dithienyl+disulfide


9,874  results were found

Refine Results Sort by
SearchResultCount:"9874"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-76303-584

Human Recombinant PDGF-BB (from E. coli)

Catalog Number: (76303-584)
Supplier: Peprotech
Description: PDGFs are disulfide-linked dimers consisting of two 12.0-13.5 kDa polypeptide chains, designated PDGF-A and PDGF-B chains. The three naturally occurring PDGFs, PDGF-AA, PDGF-BB and PDGF-AB, are potent mitogens for a variety of cell types, including smooth muscle cells, connective tissue cells, bone and cartilage cells, and some blood cells. The PDGFs are stored in platelet alpha-granules, and are released upon platelet activation. The PDGFs are involved in a number of biological processes, including hyperplasia, chemotaxis, embryonic neuron development, and respiratory tubule epithelial cell development. Two distinct signaling receptors used by PDGFs have been identified and named PDGFR-alpha and PDGFR-beta. PDGFR-alpha is a high-affinity receptor for each of the three PDGF forms. On the other hand, PDGFR-beta interacts with only PDGF-BB and PDGF-AB. Recombinant Human PDGF-BB is a 24.3 kDa disulfide-linked homodimer of two beta chains (218 total amino acids).
Image Unavailable-103003-364

Human hBD-1

Catalog Number: (103003-364)
Supplier: Anaspec Inc
Description: Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds
Sequence:DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK
(Disulfide bridge: 5-34, 12-27, 17-35)
MW:3929.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-CA10064-362

hEGF - Human Epidermal Growth Factor

Catalog Number: (CA10064-362)
Supplier: LONZA PHARMA - BIOSCIENCE CA
Description: Epidermal growth factor (EGF), is a growth factor that stimulates cell growth, proliferation, and differentiation by binding to its receptor EGFR. Human EGF is a 6045-Da protein with 53 amino acid residues and three intramolecular disulfide bonds EGF results in cellular proliferation, differentiation, and survival.

Certificates


Image Unavailable-10779-220

Human Recombinant BMP-5 (from CHO cells)

Supplier: Peprotech
Description: TGF-β family members are key modulators of cell proliferation, differentiation, matrix synthesis, and apoptosis. As implied by their name, BMPs initiate, promote, and regulate the development, growth, and remodeling of bone and cartilage. In addition to this role, BMPs are also involved in prenatal development and postnatal growth, remodeling, and maintenance of a variety of other tissues and organs. BMP-5 is expressed in the nervous system, lungs and liver. It is a known regulator for dendritic growth in sympathetic neurons. BMP-5 is a 454 amino acid precursor protein that is cleaved to release the biologically active C-terminal mature protein. Recombinant Human BMP-5 is a 31.2 kDa homodimeric disulfide-linked protein consisting of two identical 138 amino acid chains.

Image Unavailable-10781-780

Human Recombinant NGF beta (from E. coli)

Supplier: Peprotech
Description: β-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4.  These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures.  β-NGF is a potent neurotrophic factor that signals through its receptor β-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems.  β-NGF also acts as a growth and differentiation factor for B lymphocytes, and enhances B-cell survival.  The functional form of Recombinant Human β-NGF is a non-covalently-linked homodimer of two 13.5 kDa, polypeptide monomers that each contain 120 amino acids and three disulfide bonds, which are required for biological activity.Manufactured using all Animal-Free reagents.

Image Unavailable-76303-724

Human;Mouse;Rat Recombinant GDF-11 (from E. coli)

Catalog Number: (76303-724)
Supplier: Peprotech
Description: GDF-11 is a myostatin-homologous protein that acts as an inhibitor of nerve tissue growth. GDF-11 has been shown to suppress neurogenesis through a myostatin-like pathway, which involves the arrest of the progenitor cell cycle in the G1 phase. Similarities between myostatin and GDF-11, which are 90% identical in their amino acid sequence, suggest that the regulatory mechanisms responsible for maintaining proper tissue size during neural and muscular development might be the same. Recombinant Human/Murine/Rat GDF-11 is a 25.0 kDa disulfide-linked homodimer containing two 109 amino acid polypeptide chains. It is highly homologous to myostatin/GDF-8, sharing 90% amino acid sequence identity.
Image Unavailable-10773-428

Mouse Recombinant Noggin (from E. coli)

Supplier: Peprotech
Description: Noggin belongs to a group of diffusible proteins that bind to ligands of the TGF-β family, and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action was critical for proper formation of the head and other dorsal structures. Consequently, noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of noggin in mice results in prenatal death, and a recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. Recombinant Murine Noggin is a 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Certificates

Image Unavailable-B-4190.0025BA

Fmoc-L-allylglycine

Supplier: Bachem Americas
Description: Allylglycine-containing peptides may be cleaved selectively at the amide bond between allylglycine and the subsequent amino acid with iodine. The lateral double bond allows selective modifications of a peptide e.g. via metathesis. Replacing cysteine residues by allylglycine allows to obtain carba-analogs of disulfide-bridged peptides.Educt for obtaining Fmoc-prenylglycine.

Image Unavailable-10389-176

Anti-PRDX1 Rabbit Polyclonal Antibody (Cy5®)

Catalog Number: (10389-176)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-10389-182

Anti-PRDX1 Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10389-182)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-10389-174

Anti-PRDX1 Rabbit Polyclonal Antibody (Cy3®)

Catalog Number: (10389-174)
Supplier: Bioss
Description: Involved in redox regulation of the cell. Reduces peroxides with reducing equivalents provided through the thioredoxin system but not from glutaredoxin. May play an important role in eliminating peroxides generated during metabolism. Might participate in the signaling cascades of growth factors and tumor necrosis factor-alpha by regulating the intracellular concentrations of H(2)O(2). Reduces an intramolecular disulfide bond in GDPD5 that gates the ability to GDPD5 to drive postmitotic motor neuron differentiation (By similarity).
Image Unavailable-10779-090

Human;Mouse;Rat Recombinant BMP-2 (from E. coli)

Supplier: Peprotech
Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis, and is expressed in a variety of tissues, including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human/Murine/Rat BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains.

Image Unavailable-10778-144

Human Recombinant BMP2 (from E. coli)

Supplier: Peprotech
Description: BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis, and is expressed in a variety of tissues, including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains. Manufactured using all Animal-Free reagents.

Image Unavailable-H-2250.0001BA

Human Calcitonin Trifluoroacetate

Supplier: Bachem Americas
Description: For Elcatonin see H-2214.

Image Unavailable-10778-512

Mouse Recombinant Noggin (from E. coli)

Supplier: Peprotech
Description: Noggin belongs to a group of diffusible proteins that bind to ligands of the TGF-β family, and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action was critical for proper formation of the head and other dorsal structures. Consequently, noggin has been shown to modulate the activities of other BMPs including BMP-2,-7,-13, and -14. Targeted deletion of noggin in mice results in prenatal death, and a recessive phenotype displaying a severely malformed skeletal system. Conversely, transgenic mice over-expressing noggin in mature osteoblasts display impaired osteoblastic differentiation, reduced bone formation, and severe osteoporosis. Recombinant Murine Noggin is a 46.4 kDa disulfide-linked homodimer consisting of two 206 amino acid polypeptide chains.

Image Unavailable-10780-422

Human Recombinant LIF (from E. coli)

Supplier: Peprotech
Description: LIF is a pleiotrophic factor produced by multiple cell types, including T cells, myelomonocytic lineages, fibroblasts, liver, heart and melanoma. LIF promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Other activities include the stimulation of acute phase protein synthesis by hepatocytes, stimulation of differentiation of cholinergic nerves, and suppression of adipogenesis by inhibiting the lipoprotein lipase in adipocytes. While human LIF is active on mouse cells and is widely used in the maintenance of murine ESC to prevent spontaneous differentiation, mouse LIF is not active on human cells due to its inability to bind to the human LIF receptor. Recombinant Human LIF is a 19.6 kDa protein containing 180 amino acids residues, including three disulfide bonds.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
497 - 512 of 9,874
no targeter for Bottom