Print…

You Searched For: (4-Chlorophenylthio)acetic+acid


66,617  results were found

Refine Results Sort by
SearchResultCount:"66617"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-A-4320.0001BA

N-Boc-N'-Fmoc-diaminoacetic acid

Supplier: Bachem Americas
Description: Sequence: Fmoc-α-amino-DL-Gly(Boc)-OH

Image Unavailable-TCB3642-5G

tert-Butyl (4R,6R)-6-cyanomethyl-2,2-dimethyl-1,3-dioxane-4-acetate ≥98.0% (by GC, total nitrogen)

Catalog Number: (TCB3642-5G)
Supplier: TCI America
Description: CAS Number: 125971-94-0
MDL Number: MFCD03093958
Molecular Formula: C14H23NO4
Molecular Weight: 269.34
Purity/Analysis Method: >98.0% (GC,N)
Form: Crystal
Melting point (°C): 69
Specific rotation [a]20/D: -10 deg (C=1, CHCl3)

SDS


Image Unavailable-TCB4307-25G

4-tert-Butylphenylacetic acid ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 32857-63-9
MDL Number: MFCD00082593
Molecular Formula: C12H16O2
Molecular Weight: 192.26
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 81

SDS Certificates

Product Image-CA200067-224

Nb.BtsI

Catalog Number: (CA200067-224)
Supplier: New England Biolabs (NEB)
Description: An E.coli strain that expresses only the large subunit of the BtsI restriction gene from Bacillus thermoglucosidasius (X.Pan).
Product Image-CA101444-796

Hpy166II

Catalog Number: (CA101444-796)
Supplier: New England Biolabs (NEB)
Description: An E. coli strain that carries the cloned Hpy166II gene from Helicobacter pylori J166 (M.J. Blaser).
Image Unavailable-TCC0473-500G

trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate ≥99.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 125572-95-4
MDL Number: MFCD00149243
Molecular Formula: C14H22N2O8
Molecular Weight: 346.34
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 216

SDS Certificates

Product Image-CA101418-182

PspOMI

Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned PspOMI gene from Pseudomonas species OM2164, (S.K. Degtyarev).

Image Unavailable-B-1330.0025BA

N-Fmoc-glycine

Supplier: Bachem Americas
Description: Sequence: Fmoc-Gly-OH

Product Image-CABJ071-4

N,N-Dimethylacetamide ≥99.5%, B&J Brand™ for HPLC, for gas chromatography, for spectrophotometry, Burdick & Jackson™

Supplier: Burdick & Jackson
Description: For HPLC, liquid and gas chromatography, pesticide residue analysis, spectophotometry, organic synthesis and combinatorial chemistry.

SDS Certificates

Image Unavailable-CAAAAL06241-30

Methyl isovalerate 98%

Supplier: Thermo Scientific Chemicals
Description: Methyl isovalerate 98%

Certificates

Image Unavailable-C-1635.0001BA

Z-Gln-Gly-OH ≥99% (by TLC)

Supplier: Bachem Americas
Description: Substrate for tissue transaminase.

Product Image-CA102715-928

PluTI

Catalog Number: (CA102715-928)
Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned PluTI gene from Photorhabdus luminescens.
Product Image-CA101418-192

ZraI

Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned ZraI gene from Zoogloea ramigera 11, (S.K. Degtyarev).

Image Unavailable-TCC2396-100G

Chitosan, 20-100 mPa.s (20 °C) 0.5% in acetic acid (0,5%)

Supplier: TCI America
Description: CAS Number: 9012-76-4
MDL Number: MFCD00161512
Form: Crystal
Color: Very Pale Yellow

SDS Certificates

Image Unavailable-TCB4214-5G

tert-Butyl (3R,5S)-6-hydroxy-3,5-O-isopropylidene-3,5-dihydroxyhexanoate ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 124655-09-0
MDL Number: MFCD23098985
Molecular Formula: C13H24O5
Molecular Weight: 260.33
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Specific Gravity (20/20): 1.06
Specific rotation [a]20/D: -4 deg (C=2, MeOH)
Storage Temperature: 0-10°C

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
945 - 960 of 66,617
no targeter for Bottom