Print…

You Searched For: (2-Bromophenyl)acetic+acid


70,820  results were found

Refine Results Sort by
SearchResultCount:"70820"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-N-1195.0025BA

DL-Thiorphan

Supplier: Bachem Americas
Description: Sequence: ((RS)-2-Benzyl-3-mercaptopropionyl)-Gly-OH

Image Unavailable-CAAAB22264-03

(±)-4-(Trifluoromethyl)mandelic acid 98%

Supplier: Thermo Scientific Chemicals
Description: (±)-4-(Trifluoromethyl)mandelic acid 98%

Image Unavailable-TCC2682-1G

Cloquintocet mexyl ≥98.0% (by HPLC, titration analysis)

Catalog Number: (TCC2682-1G)
Supplier: TCI America
Description: CAS Number: 99607-70-2
MDL Number: MFCD01632329
Molecular Formula: C18H22ClNO3
Molecular Weight: 335.83
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 70

SDS


Image Unavailable-77984-937

TRC (4R,6S)-6-[(1E)-2-[4-(4-Fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-dioxane-4-acetic Acid 1,1-Dimethylethyl Ester

Supplier: LGC Standards
Description: TRC (4R,6S)-6-[(1E)-2-[4-(4-Fluorophenyl)-6-(1-methylethyl)-2-[methyl(methylsulfonyl)amino]-5-pyrimidinyl]ethenyl]-2,2-dimethyl-1,3-dioxane-4-acetic Acid 1,1-Dimethylethyl Ester

New Product

Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-TCD1431-025ML

Methyl dihydrojasmonate (cis and trans mixture) ≥95.0%

Catalog Number: (TCD1431-025ML)
Supplier: TCI America
Description: CAS Number: 24851-98-7
MDL Number: MFCD00151188
Molecular Formula: C13H22O3
Molecular Weight: 226.32
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 110
Flash Point (°C): 156
Specific Gravity (20/20): 1.00

SDS Certificates


Image Unavailable-TCA0313-025G

4-Aminohippuric acid ≥99.0% (by titrimetric analysis)

Supplier: TCI America
Description: CAS Number: 61-78-9
MDL Number: MFCD00007890
Molecular Formula: C9H10N2O3
Molecular Weight: 194.19
Purity/Analysis Method: >99.0% (T)
Form: Crystal
Melting point (°C): 197

Certificates

Image Unavailable-CAAAAL15368-14

Bzl-Gly-OH ≥98%

Supplier: Thermo Scientific Chemicals
Description: Bzl-Gly-OH ≥98%

Certificates

Image Unavailable-89156-578

Sulindac sulfone ≥94% (by HPLC)

Supplier: Enzo Life Sciences
Description: Induces apoptosis but does not inhibit cyclooxygenase. Inhibits growth and induces apoptosis in human cancer cell lines. Metabolite of Sulindac.

Image Unavailable-CAAAA10292-AE

Ethyl isovalerate 98%

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00009203 Beilstein Registry No.: 1744677

Certificates

Image Unavailable-75800-934

50X TAE (Tris-Acetate EDTA), pH 8.3

Supplier: GROWCELLS
Description: TAE buffer is used in agarose gel electrophoresis and Polyacrylamide gels both as a buffer and a component of a gel

Image Unavailable-TCD2489-005G

N-Decanoylsarcosine sodium salt ≥98.0% (by titrimetric analysis)

Catalog Number: (TCD2489-005G)
Supplier: TCI America
Description: CAS Number: 30377-07-2
MDL Number: MFCD00451533
Molecular Formula: C13H25NO3
Molecular Weight: 265.33
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 155

SDS


Image Unavailable-75811-010

EDTA disodium salt dihydrate ≥99.0% FCC

Supplier: Spectrum Chemicals
Description: Disodium EDTA, Dihydrate, FCC is used as a preservative to inhibit discoloration. Spectrum Chemical manufactured FCC products, including all FCC Disodium products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities

Product Image-CA102902-460

BssSI-v2

Supplier: New England Biolabs (NEB)
Description: An E.coli strain that carries the cloned and modified BssSI gene from Bacillus stearothermophilus S719 (Z. Chen).

Image Unavailable-CAAA11651-18

Copper(II) perchlorate hexahydrate, REacton®, Reagent Grade

Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00149666 Soluble in water, methanol, ethanol, acetic acid, acetic anhydride, and acetone

Certificates

Image Unavailable-B-3640.1000BA

(S)-2-((((9H-Fluoren-9-yl)methoxy)carbonyl)amino)-2-cyclopentylacetic acid

Supplier: Bachem Americas
Description: Sequence: Fmoc-Cpg-OH

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,025 - 1,040 of 70,820
no targeter for Bottom