Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103008-000

[Lys(Me1)27]-Histone H3 (21-44)-GK 0.25 mg

Description: [Lys(Me1)27]-Histone H3 (21-44)-GK(Biotin), H3K27(Me1), biotin-labeled, Sequence: ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin), Purity: By HPLC >/= 95%, Histone H3 amino acid residues 21 to 44 mono-methylated, Molecular Weight: 2931.5, Size: 0.25 mg
Catalog Number: 103008-000
Supplier: Anaspec Inc
Image Unavailable-102996-324

Beta-Amyloid (2-16)-Lys(Biotin-LC)-NH2 0.5mg

Description: Beta-Amyloid (2-16)-Lys(Biotin-LC)-NH2, Human, Purity: HPLC >/= 95%, Molecular Weight: 2288.6, Sequence: H-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Lys-NH2This C-terminal biotinylated A beta contains a 6-carbon long chain, Size: 0.5mg
Catalog Number: 102996-324
Supplier: Anaspec Inc
Image Unavailable-103011-232

Calcein blue, AM 1 mg

Description: Calcein blue, AM, Blue fluorescent cell viability indicator, Molecular Weight: 465.4, Spectral Properties: Abs/Em = 322/437 nm, Solvent System: DMSO, Physical State: Solid, Storage: -20 deg C, desiccated and protected from light, Store away from oxidizing agent, Size: 1 mg
Catalog Number: 103011-232
Supplier: Anaspec Inc
Image Unavailable-103011-256

RH414 5 mg

Description: RH414, Synonym: N-(3-Triethylammoniumpropyl)-4-(4-(4-(diethylamino)phenyl)butadienyl) pyridinium dibromide, Widely used for functional imaging of neurons, Molecular Weight: 581.5, Spectral Properties: Abs/Em = 532/716 nm, MF: C28H43Br2N3, Form: Solid, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103011-256
Supplier: Anaspec Inc
Image Unavailable-103007-480

Deltorphin B 1 mg

Description: Deltorphin B, Sequence: YaFEVVG-NH2, Purity: By HPLC greater than or equal to 95%, Deltorphin B (or Deltorphin II) was first isolated from the skin of Phyllomedusa bicolor, Molecular Weight: 782.9, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-480
Supplier: Anaspec Inc
Image Unavailable-103008-326

[Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin) H3K18(Me1) 1mg

Description: [Lys(Me1)18]-Histone H3 (1-21)-GGK(Biotin), H3K18(Me1), Purity: Greater than or equal to 95% (HPLC), Molecular weight: 2736.2, Sequence: ARTKQTARKSTGGKAPR-K(Me1)-QLA-GGK(Biotin)-NH2, Label: Biotin, 0, Storage: -20 degree C, Size: 1mg
Catalog Number: 103008-326
Supplier: Anaspec Inc
Image Unavailable-102996-760

390 MMP FRET Substrate I 1 mg

Description: 390 MMP FRET Substrate I, Purity: HPLC >/= 95%, Molecular Weight: 1093.2, Sequence: Mca-Pro-Leu-Gly-Leu-Dap(Dnp)-Ala-Arg-NH2, Appearance: Lyophilized yellow powder, A fluorogenic substrate that is best cleaved by MMP-7, 8, 9 and 13, Size: 1 mg
Catalog Number: 102996-760
Supplier: Anaspec Inc
Image Unavailable-102996-516

[Arg8]-Vasopressin (AVP)1 mg

Description: [Arg8]-Vasopressin (AVP), Purity: HPLC >/= 95%, Molecular Weight: 1084.3, Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2, identified as an important regulator of fluid and electrolyte homeostasis through its anti-diuretic action on the kidney, Size: 1 mg
Catalog Number: 102996-516
Supplier: Anaspec Inc
Image Unavailable-103007-750

gp91 ds-tat, sgp91 ds-tat scrambled 1 mg

Description: gp91 ds-tat, sgp91 ds-tat, scrambled, Sequence: YGRKKRRQRRRCLRITRQSR-NH2, Purity: By HPLC greater than or equal to 95%, This is a control peptide for gp91 ds-tat, Molecular Weight: 2673.2, Apperance: powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-750
Supplier: Anaspec Inc
Image Unavailable-102999-618

Cys - beta - Amyloid (1 - 42) 0.1 mg

Description: Cys - beta - Amyloid (1 - 42), Human, Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: HPLC greater than or equal to 95%, Molecular Weight: 4617.3, Apperance: Powder, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 102999-618
Supplier: Anaspec Inc
Image Unavailable-103009-362

[Arg(Me2a)3]-Histone H4

Description: [Arg(Me2a)3]-Histone H4 (1-23)-GGK, Purity: HPLC >/= 95%, MW: 2857.4, Sequence: [SG-R(Me2a)-GKGGKGLGKGGAKRHRKVLRGG-K(Biotin)] asymmetrically dimethylated at Arg3 followed by a biotinylated Lys conjugated to a C-terminal GG linker. Store: -20 deg C, Size: 1mg
Catalog Number: 103009-362
Supplier: Anaspec Inc
Image Unavailable-103007-108

Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(LC - biotin) - NH2, FAM - labeled, Human, FABB, Purity: By HPLC greater than or equal to 95%, biotinylated on the lysine side chain, Molecular Weight: 5154.9, Storage: -20 deg C, Size: 0.1 mg
Catalog Number: 103007-108
Supplier: Anaspec Inc
Image Unavailable-103007-974

[Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin) H3K9(Me1) 1 mg

Description: [Lys(Me1)9]-Histone H3 (1-21)-GGK(Biotin), H3K9(Me1), biotin-labeled, Sequence: ARTKQTAR-K(Me1)-STGGKAPRKQLA-GGK(Biotin), Purity: By HPLC >/= 95%, Residues 1 to 21 mono-methylated at Lys-9, Molecular Weight: 2737.2, Size: 1 mg
Catalog Number: 103007-974
Supplier: Anaspec Inc
Image Unavailable-103001-340

Anti-PLP (178-191) IgG Quantitative ELISA Kit

Description: SensoLyte* Anti-PLP (178-191) IgG Quantitative ELISA Kit (Mouse) Colorimetric, determine anti-PLP (178-191) IgG antibody, Wells are pre-coated with PLP peptide and pre-blocked with BSA, Storage: At 2-8 degree C, Size: One 96-well strip plate
Catalog Number: 103001-340
Supplier: Anaspec Inc
Image Unavailable-102999-750

Beta - Amyloid (11 - 22) 1 mg

Description: Beta - Amyloid (11 - 22), Human, Sequence: EVHHQKLVFFAE, Purity: HPLC greater than or equal to 95%, Molecular Weight: 1483.7, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102999-750
Supplier: Anaspec Inc
Image Unavailable-103007-346

Beta - Amyloid (17 - 28) 1 mg

Description: Beta - Amyloid (17 - 28), Human, mouse/rat, Sequence: LVFFAEDVGSNK, This peptide is amino acids 17 to 28 fragment of beta-amyloid, Molecular Weight: 1325.5, Apperance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103007-346
Supplier: Anaspec Inc
49 - 64 of 1,262