Print…

You Searched For: Anaspec Inc


2,051  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"2051"

Rate These Search Results

Image Unavailable-103008-518

Human [Lys(Ac)382]-p53 (361-393), Biotin, AnaSpec

Description: Human [Lys(Ac)382]-p53 (361-393), Biotin, AnaSpec
Catalog Number: 103008-518
Supplier: Anaspec Inc
Image Unavailable-103006-812

Human Insulin B (9-23)

Description: Human Insulin B (9-23)
Catalog Number: 103006-812
Supplier: Anaspec Inc
Image Unavailable-103008-032

[Lys(Me2)27]-Histone H3 (23-34) H3K27(Me2) 1 mg

Description: [Lys(Me2)27]-Histone H3 (23-34), H3K27(Me2), Sequence: KAAR-K(Me2)-SAPATGG, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 23 to 34 di-methylated at Lys-27, Molecular Weight: 1142.3, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103008-032
Supplier: Anaspec Inc
Image Unavailable-103006-882

E alpha (52–68)

Description: E alpha (52–68)
Catalog Number: 103006-882
Supplier: Anaspec Inc
Image Unavailable-103007-254

Bacterial Sortase Substrate I

Description: Bacterial Sortase Substrate I
Catalog Number: 103007-254
Supplier: Anaspec Inc
Image Unavailable-103010-466

SensoLyte* 520 Thrombin Activity Assay Kit

Description: SensoLyte* 520 Thrombin Activity Assay Kit *Fluorimetric*, Components: Thrombin substrate 2 mM, 50 ul, 5-FAM 2 mM, 10 ul, 2X Assay buffer 20 mL, Purified human thrombin enzyme 0.1 mg/mL, 40 ul,Thrombin inhibitor 60 u
M, 10 ul, Stop solution 5 mL
Catalog Number: 103010-466
Supplier: Anaspec Inc
Image Unavailable-103006-886

Hen Elafin

Description: Hen Elafin
Catalog Number: 103006-886
Supplier: Anaspec Inc
Image Unavailable-103010-746

5(6) - FAM 250 mg

Description: 5(6)-FAM [[5-(and-6)-Carboxyfluorescein] *UltraPure Grade* *Mixed Isomers*], Purity: >90% purity HPLC, Molecular Formula: C21H12O7, Molecular Weight: 376.32, Appearance: Orange solid, Solvent System DMF or DMSO, used to prepare fluoresceinated bioconjugates, size: 250 mg
Catalog Number: 103010-746
Supplier: Anaspec Inc
Image Unavailable-103010-234

SensoLyte* 520 MMP-3 Assay Kit

Description: SensoLyte* 520 MMP-3 Assay Kit * Fluorimetric*, Components: MMP-3 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability
Catalog Number: 103010-234
Supplier: Anaspec Inc
Image Unavailable-103011-166

Indo-1 AM calcium sensor dye

Description: Indo-1 AM calcium sensor dye
Catalog Number: 103011-166
Supplier: Anaspec Inc
Image Unavailable-103011-054

DABCYL Plus™ acid, SE ≥95%

Description: DABCYL Plus™ acid, SE ≥95%
Catalog Number: 103011-054
Supplier: Anaspec Inc
Image Unavailable-103006-372

PrP (106-126)

Description: PrP (106-126)
Catalog Number: 103006-372
Supplier: Anaspec Inc
Image Unavailable-103007-216

[Lys22] - beta - Amyloid (1 - 42) 0.5 mg

Description: [Lys22] - beta - Amyloid (1 - 42), Italian Mutation, Human, Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC >/= 95%, lysine substituted for glutamic acid at position 22, Molecular Weight: 4513.2, Storage: -20 C, Size: 0.5 mg
Catalog Number: 103007-216
Supplier: Anaspec Inc
Image Unavailable-103009-020

Cyclo[ - RGDy - K(5 - FAM)] 1mg

Description: Cyclo[ - RGDy - K(5 - FAM)], Purity: Greater than or equal to 95% (HPLC), Molecular weight: 978, Sequence: Cyclo[ - RGDy - K(5 - FAM)], peptide is a 5-FAM-labeled cylic RGDyK peptide, serve as ligands for av-integrin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103009-020
Supplier: Anaspec Inc
Image Unavailable-103003-306

Fluorescein biotin 5 mg

Description: Fluorescein biotin [[5-((N-(5-(N-(6-(Biotinoyl)amino)hexanoyl)amino)pentyl)thioureidyl) fluorescein]], Molecular Weight: 831, Appearance: solid, Solvent System: DMSO or DMF, Green fluorescent biotin used for studying avidin binding, Storage: -20 deg C, Size: 5 mg
Catalog Number: 103003-306
Supplier: Anaspec Inc
Image Unavailable-103006-056

[Ala8] - Humanin, [Ala8] - HN, sHNA 1 mg

Description: [Ala8] - Humanin, [Ala8] - HN, sHNA, Purity: By HPLC >/= 95%, Molecular Weight: 2655.2, Sequence: (One-Letter Code): MAPRGFSALLLLTSEIDLPVKRRA Protection activity of humanin (HN), Physical State: White Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103006-056
Supplier: Anaspec Inc
1 - 16 of 2,051