Print…

You Searched For: Anaspec Inc


1,262  results were found

Refine Results Sort by

Sort Results

List View Easy View
SearchResultCount:"1262"

Rate These Search Results

Image Unavailable-103003-042

Beta-Amyloid (1-37) 1mg

Description: Beta-Amyloid (1-37), Human, Purity: Greater than or equal to 95% (% Peak Area By HPLC), Molecular weight: 4074.6, Sequence: (One-Letter Code) AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVG, Storage: At -20 degree C, Size: 1mg
Catalog Number: 103003-042
Supplier: Anaspec Inc
Image Unavailable-103006-812

Insulin B (9-23) 1 mg

Description: Insulin B (9-23) insulin B-chain peptide binds to a class II histocompatibility complex (MHC) allele called I-Ag7, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): SHLVEALYLVCGERG, Molecular Weight: 1645.9, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-812
Supplier: Anaspec Inc
Image Unavailable-103011-276

DiSC3(5) 100 mg

Description: DiSC3(5), Synonym: 3,3'-Dipropylthiadicarbocyanine iodide, Accumulate in cells on hyperpolarized membranes, Molecular Weight: 546.5, Spectral Properties: Abs/Em = 651/675 nm, Solvent System: DMSO, CAS number: 53213-94-8, Molecular formula: C25H27IN2S2, Storage -20C, Size: 100 mg
Catalog Number: 103011-276
Supplier: Anaspec Inc
Image Unavailable-103007-972

Antennapedia Peptide FAM-labeled 1 mg

Description: Antennapedia Peptide, FAM-labeled, Sequence: 5-FAM-RQIKIWFQNRRMKWKK-NH2, Purity: By HPLC >/= 95%, This peptide is also called penetratin and this product is FAM-labeled with Abs/Em = 492/518 nm, Molecular Weight: 2604.1, Storage: -20 C, Size: 1 mg
Catalog Number: 103007-972
Supplier: Anaspec Inc
Image Unavailable-103007-842

Srctide, biotinylated 1 mg

Description: Srctide, biotinylated, Sequence: Biotin-GEEPLYWSFPAKKK-NH2, Purity: By HPLC >/= 95%, peptide substrate for many protein kinases, such as Blk, BTK, cKit, EPHA1, EPHB2, EPHB3, ERBB4, FAK, Flt3, IGF-1R, ITK, Lck, MET, MUSK, Molecular Weight: 1905.3, Size: 1 mg
Catalog Number: 103007-842
Supplier: Anaspec Inc
Image Unavailable-103011-378

BSB 5 mg

Description: BSB, Synonym: (trans,trans) - 1 - Bromo-2,5-bis-(3-hydroxycarbonyl-4-hydroxy)styrylbenzene, Molecular Weight: 481.3, Spectral Properties: Abs/Em = 340/520 nm, Solvent System: DMSO, CAS Number: 56776-28-4, Appearance: powder, derived from the structure of Congo Red, Size: 5 mg
Catalog Number: 103011-378
Supplier: Anaspec Inc
Image Unavailable-103010-900

DEAC, SE 25 mg

Description: DEAC, SE, Synonym: 7-Diethylaminocoumarin-3-carboxylic acid, succinimidyl ester, Purity: >/=95% by HPLC, blue fluorescent building block for labeling amine-containing biomolecules, MW: 358.35, Spectral Properties: Abs/Em = 432/472 nm, Solvent System DMF or Acetonitrile, Size: 25 mg
Catalog Number: 103010-900
Supplier: Anaspec Inc
Image Unavailable-103003-546

Beta - Amyloid (1 - 40) - Lys(Biotin - LC) 0.1 mg

Description: Beta - Amyloid (1 - 40) - Lys(Biotin - LC), Human, Purity: HPLC >/- 95%, Molecular Weight: 4797.5, Appearance: Lyophilized white powder, Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV-K, contains a 6-carbon long chain, size: 0.1 mg
Catalog Number: 103003-546
Supplier: Anaspec Inc
Image Unavailable-103006-886

Elafin 1 mg

Description: Elafin, Purity: HPLC >/= 95%, Sequence (One-Letter Code): AQEPVKGPVSTKPGSCPIILIRCAMLNPPNRCLKDTDCPGIKKCCEGSCGMACFVPQ (Disufide bonds between Cys16- Cys45, Cys23- Cys49, Cys32- Cys44, Cys38-Cys53), MW: 5999.3, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg
Catalog Number: 103006-886
Supplier: Anaspec Inc
Image Unavailable-103010-234

SensoLyte* 520 MMP-3 Assay Kit

Description: SensoLyte* 520 MMP-3 Assay Kit * Fluorimetric*, Components: MMP-3 substrate 60 ul, 5-FAM-Pro-Leu-OH 1 mM, 10 ul, APMA 1 M, 20 ul, Assay buffer 20 mL, Stop solution 10 mL, with Convenient Format, Optimized Performance, Enhanced Value, High Speed, Assured Reliability
Catalog Number: 103010-234
Supplier: Anaspec Inc
Image Unavailable-103003-738

Orexin A 1 mg

Description: Orexin A, bovine, human, mouse, rat, Purity: HPLC >/- 95%, Molecular Weight: 3561.2, Sequence: Pyr-PLPDCCRQKTCSCRLYELLHGAGNHAAGILTL-NH2, Appearance: Lyophilized white powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 103003-738
Supplier: Anaspec Inc
Image Unavailable-103006-344

GRGDS 5 mg

Description: GRGDS, Induces dissociation of alpha-actinin and vinculin from the sites of focal contacts, causes rounding and detachment of spread cells, Purity: HPLC >/=95%, Sequence (One-Letter Code): GRGDS, Molecular weight: 490.5, Physical State: Powder, Storage: -20 degree C, Size: 5 mg
Catalog Number: 103006-344
Supplier: Anaspec Inc
Image Unavailable-102996-098

Fibrinopeptide A 1 mg

Description: Fibrinopeptide A, human, Purity: HPLC >/= to 95%, Molecular Weight: 1536.6, Sequence: ADSGEGDFLAEGGGVR, Appearance: Powder, Storage: -20 deg C, Size: 1 mg
Catalog Number: 102996-098
Supplier: Anaspec Inc
Image Unavailable-103009-070

[Lys(Ac)12/16]-Histone H4(1-25)-GSGSK H4K12/16(Ac) 1mg

Description: [Lys(Ac)12/16]-Histone H4(1-25)-GSGSK(Biotin); H4K12/16(Ac), Purity: Greater than or equal to 95%(HPLC), Molecular weight: 3316.8, Sequence: SGRGKGGKGLG-K(Ac)-GGA-K(Ac)-RHRKVLRDNGSGS-K(Biotin), Label: Biotin, Storage: -20 degree C, Size: 1mg
Catalog Number: 103009-070
Supplier: Anaspec Inc
Image Unavailable-103011-014

Sulforhodamine 101 C2 maleimide 5 mg

Description: Sulforhodamine 101 C2 maleimide, thiol-reactive reagent for protein modification as amino acid, peptides and protein, MW: 728.84, Spectral: Abs/Em = 588/601 nm, Solvent System: DMF or DMSO, Storage: -20 deg C Store away from oxidizing agent, Size: 5 mg
Catalog Number: 103011-014
Supplier: Anaspec Inc
Image Unavailable-103007-606

[Arg6]-beta-Amyloid (1-40) English Mutation 0.5 mg

Description: [Arg6]-beta-Amyloid (1-40), English Mutation, Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, amino acids 1 to 42 beta-amyloid with the England mutation, Molecular Weight: 4533.2, Size: 0.5 mg
Catalog Number: 103007-606
Supplier: Anaspec Inc
1 - 16 of 1,262