You Searched For: Anaspec Inc

Description: Mouse MBP (4-14)

Catalog Number: 102999-378

Supplier: Anaspec Inc

Sale

Description: AnaTag™ B-PE Labeling Kit

Catalog Number: 103010-182

Supplier: Anaspec Inc

Sale

Description: MUC1

Catalog Number: 103003-254

Supplier: Anaspec Inc

Sale

Description: Autocatamide-2 Peptide

Catalog Number: 103003-032

Supplier: Anaspec Inc

Sale

Description: 5-Carboxytetramethylrhodamine (5-TAMRA) special formulation

Catalog Number: 103010-836

Supplier: Anaspec Inc

Sale

Description: Histone H3 (21-44)-GK, Biotin

Catalog Number: 103008-160

Supplier: Anaspec Inc

Sale

Description: H-Gly-Pro-AMC, Purity: HPLC >/= 95%, Molecular Weight: 329.2, Sequence: H-Gly-Pro-AMC, Appearance: Powder, This is a fluorescent dipeptidylaminopeptidase IV substrate, Abs/Em=353/442 nm, Storage: -20 deg C, Size: 10 mg

Catalog Number: 102996-430

Supplier: Anaspec Inc

Sale

Description: CEF20, Cytomegalovirus, CMV pp65 (495 - 503), HLA-A*0201-restricted epitope from Cytomegalovirus pp65 (495-503), Molecular Weight: 943.2, Sequence: NLVPMVATV, Physical State: Solid, Store away from oxidizing agent. Storage: -20 deg C, Size: 1 mg

Catalog Number: 103000-710

Supplier: Anaspec Inc

Sale

Description: Beta - Amyloid (2 - 42), Human, Purity: Peak Area By HPLC Greater than or equal to 95%, Molecular Weight: 4399, Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA, Appearance: Lyophilized white powder, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103000-896

Supplier: Anaspec Inc

Sale

Description: Human Papillomavirus (HPV) E7 protein (49 - 57), RAHYNIVTF, H-2Db-restricted epitope, Sequence (Three-Letter Code): H - Arg - Ala - His - Tyr - Asn - Ile - Val - Thr - Phe - OH, MW: 1120.3, Physical State: Powder, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103006-258

Supplier: Anaspec Inc

Sale

Description: Histone H1-derived Peptide, FAM-labeled, substrate for CDK2 and CDK5 (cyclin dependent kinase 5) and PKA, Purity: HPLC is greater than or equal to 95%, Sequence (One-Letter Code): 5-FAM-GGGPATPKKAKKL, MW: 1610.8, Storage: -20 degree C, Size: 1 mg

Catalog Number: 103006-970

Supplier: Anaspec Inc

Sale

Description: [Lys(Ac)9/14]-Histone H3 (1-21)-GGK(Biotin), H3K9/14(Ac), biotin-labeled, Sequence: ARTKQTAR-K(Ac)-STGG-K(Ac)-APRKQLA-GGK(Biotin), Purity: By HPLC greater than or equal to 95%, Molecular Weight: 2807.3, Size: 0.25 mg

Catalog Number: 103007-992

Supplier: Anaspec Inc

Sale

Description: Beta-Amyloid (23-42), Human, mouse/rat, Sequence: DVGSNKGAIIGLMVGGVVIA, Purity: By HPLC greater than or equal to 95%, This is amino acids 23 to 42 fragment of beta-amyloid, Molecular Weight: 1870.3, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103007-516

Supplier: Anaspec Inc

Sale

Description: HCV NS3/4A protease genotype 1b, recombinant, for viral replication and the formation of infectious viral particles, to screen anti-HCV protease drugs, Purity: HPLC >/=95%, Concentration: 0.2 mg/mL, Storage: -80 degree C, Size: 10 ug

Catalog Number: 103006-248

Supplier: Anaspec Inc

Sale

Description: QXL*570 acid, Molecular Weight: 597.77, Solvent System DMSO or DMF, dyes are the optimized quenchers for quenchers for rhodamines and Cy3 fluorophores, Their absorption spectra perfectly overlap with the fluorescence spectra of TAMRA, sulforhodamine B, ROX and Cy3, size: 10 mg

Catalog Number: 103010-226

Supplier: Anaspec Inc

Sale

Description: [Lys(Me1)9]-Histone H3 (3-17), H3K9(Me1), Sequence: TKQTAR-K(Me1)-STGGKAPR, Purity: By HPLC >/= 95%, peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9, Molecular Weight: 1600.8, Storage: -20 deg C, Size: 1 mg

Catalog Number: 103008-022

Supplier: Anaspec Inc

Sale