You Searched For: Desiccator+Lids


36,877  results were found

SearchResultCount:"36877"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (89139-276)
Supplier: Biotium
Description: Zinquin is an UV-excitable, blue fluorescent zinc indicator. Zinquin ethyl ester is membrane-permeable and is hydrolyzed into Zinquin free acid once entering cells. Zinc is believed to be involved in the suppression of apoptosis and thought to play important roles in many neural activities.


Supplier: TCI America
Description: CAS Number: 26787-75-7
Molecular Formula: C16H15NO5
Molecular Weight: 301.30
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -127 deg (C=10, MeOH)

SDS

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: TCI America
Description: CAS Number: 9012-76-4
MDL Number: MFCD00161512
Form: Crystal
Color: Slightly Pale Yellow
Supplier: Thermo Scientific Chemicals
Description: EDTA disodium salt dihydrate 99+%
Catalog Number: (F-2625.0001BA)
Supplier: Bachem Americas
Description: Sequence: Phenylac-Gly-OH


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00015629
Catalog Number: (470163-086)
Supplier: Ward's Science
Description: Determine Concentrations of Unknowns

SDS


Supplier: LGC Standards
Description: TRC (S)-2-Acetamido-5-ureidopentanoic Acid

New Product

Catalog Number: (TCA2192-25G)
Supplier: TCI America
Description: CAS Number: 4166-20-5
MDL Number: MFCD00799462
Molecular Formula: C8H10O4
Molecular Weight: 170.16
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 243
Flash Point (°C): 113
Specific Gravity (20/20): 1.16

Catalog Number: (CA1.09992.0001)
Supplier: MilliporeSigma
Description: Concentration after dilution to 1 liter: c(C₁₀H₁₄N₂Na₂O₈ ∙ 2 H₂O) = 0.1 mol/l

Supplier: MilliporeSigma
Description: Ethylenediaminetetraacetic Acid Dipotassium Salt Dihydrate for Synthesis Cas Number:25102-12-9 100G
Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00003541 Beilstein Registry No.: 1716295 Common Applications: Metal chelator Fieser: 1,373
Catalog Number: (BJ38057-1EA)
Supplier: Honeywell Research Chemicals
Description: For 1L standard solution

SDS


Supplier: Thermo Scientific Chemicals
Description: With bromide ion, catalyzes the liquid-phase auto-oxidation of cresols.
Supplier: Thermo Scientific Chemicals
Description: trans-1,2-Diaminocyclohexane-N,N,N',N'-tetraacetic acid monohydrate 98%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
-47 - -32 of 36,877
no targeter for Bottom