You Searched For: beta-Cholestanol

Catalog Number: (89262-242)

Supplier: Genetex

Description: Mouse Monoclonal antibody to Interleukin-1 Beta Clone: DF8 Species Reactivity: Pig Tested Applications: WB Pkg Size: 500 ug

Catalog Number: (SXS-2654-MEOH)

Supplier: SPEX CERTIPREP LLC

Description: Cannabis standard, analytical standard for medicinal and recreational cannabis testing.
Designed for Methods: State specific pesticide regulations:

Catalog Number: (76116-662)

Supplier: Bioss

Description: Laminin S binds to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminin S is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Beta 2 is a subunit of laminin 3 (Laminin S), laminin 4 (S merosin), and laminin 7 (KS laminin).

Supplier: Sino Biological

Description: Recombinant full length human p110 beta and human p85 beta were co-expressed by baculovirus in Sf9 insect cells using an N-terminal His tag on both proteins.

New Product

Catalog Number: (102869-040)

Supplier: R&D Systems

Description: The Recombinant Mouse Integrin alpha V beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha V beta 1 Protein has been validated for the following applications: Bioactivity.

Catalog Number: (10798-416)

Supplier: Prosci

Description: Transforming growth factor beta 1 ( TGFB1) is also known as TGF-?1, CED, DPD1, TGFB. is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The TGFB1 protein helps control the growth and division (proliferation) of cells, the process by which cells mature to carry out specific functions (differentiation), cell movement (motility), and the self-destruction of cells (apoptosis). The TGFB1 protein is found throughout the body and plays a role in development before birth, the formation of blood vessels, the regulation of muscle tissue and body fat development, wound healing, and immune system function. TGFB1 is particularly abundant in tissues that make up the skeleton, where it helps regulate bone growth, and in the intricate lattice that forms in the spaces between cells (the extracellular matrix). Within cells, this protein is turned off (inactive) until it receives a chemical signal to become active. TGFB1 plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages. Most immune cells (or leukocytes) secrete TGFB1. TGFB1 has been shown to interact with TGF beta receptor 1, LTBP1, YWHAE, EIF3I and Decorin.

Supplier: Abcam

Description: Rabbit monoclonal [EPR25742-21] to beta Arrestin 1 + Beta Arrestin 2 - BSA and Azide free (Capture).

New Product

Catalog Number: (CA101228-550)

Supplier: New England Biolabs (NEB)

Description: β-N-Acetylhexosaminidasef is a recombinant protein fusion of β-N-Acetyl-hexosaminidase and maltose binding protein

Catalog Number: (75791-528)

Supplier: Prosci

Description: Human IL-2RB, also known asinterleukin-2 receptor subunit beta,is the receptor for interleukin-2. IL2 receptor complex is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. IL2 receptor complex has three forms with respect to ability to bind IL2. IL-2RB is belonged to a type I membrane protein,and has a 26 residue signal peptide, a 214 residue extracellular region, a 25 residue transmembrane region and a 286 residue cytoplasmic domain. IL-2RB is the subunit critical for receptor-mediated signaling via physically or functionally coupling to other signaling molecules, such as the Jak-STAT and Src-family protein tyrosine kinase although it lacks apparent catalytic motifs.

Supplier: Anaspec Inc

Description: This peptide triggers the formation of insoluble Aß peptide deposits, inhibits secretion of amyloid protein precursor (APP) and increases cell-associated APP. The fibrils in the plaques formed in the brains of patients with Alzheimer’s disease contain significant amounts of truncated Aß proteins such as Aß(3-40) and Aß (11- 40). These two fragments contain an N-terminal pyroglutamic acid. The g-carboxy group of glutamic acid forms a cyclic bond with the free N-terminal amino group to form pyroglutamate.

Supplier: Bon Opus Biosciences

Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Supplier: TCI America

Description: CAS Number: 934591-76-1
Molecular Formula: C25H29NO12S
Molecular Weight: 567.56
Purity/Analysis Method: >96.0% (HPLC)
Form: Crystal
Melting point (°C): 152
Specific rotation [a]20/D: -123 deg (C=0.8, CHCl3)
Storage Temperature: 0-10°C

SDS

Catalog Number: (TCM2696-100MG)

Supplier: TCI America

Description: Neu5GcAc[1Me,478Ac,9N3]-B-SPh, Purity: >93.0%(HPLC), CAS Number: 1195053-25-8, MF: C26H32N4O12S, MW: 624.62, Synonyms: Methyl (Phenyl 5-Acetoxyacetamido-4,7,8-tri-O-acetyl-9-azido-3,5,9-trideoxy-2-thio-D-glycero-B-D-galacto-2-nonulopyranosid)onate, Size: 100MG

SDS

Supplier: Novus Biologicals

Description: TGF-beta RII is a membrane-bound serine/threonine kinase. Upon ligand binding, TGF-beta RII interacts with TGF-beta RI to form the heteromeric signaling complex that transduces TGF-beta signals. A splice variant of the type II receptor, TGF-beta RIIb, containing a 25 amino acid residue insertion near the N-terminus of the mature protein has also been described.

Supplier: Anaspec Inc

Description: This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (76078-792)

Supplier: Bioss

Description: Beta-defensins (also designated BD, and hBD in human) are small cationic peptides with broad-spectrum antimicrobial activity. Produced in mucosal epithelia and neutrophils of several species, Beta-defensins are developmentally regulated. Human b-defensin 2 is locally regulated by inflammation and is the first member of the b-defensin family that is locally inducible by inflammation. The murine homolog of human b-defensin 2, which is called b-defensin 3, is present in the respiratory system and in low levels in the epithelial cells of the intestine and lung. The unique murine b-defensin 2 (Defb2) is not expressed in airways of untreated mice, but is upregulated in the airways by lipopolysaccharide and may contribute to host defense at the mucosal surface of the airways.