You Searched For: Dimethylmalonic+acid


19,814  results were found

SearchResultCount:"19814"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10798-416)
Supplier: Prosci
Description: Transforming growth factor beta 1 ( TGFB1) is also known as TGF-?1, CED, DPD1, TGFB. is a polypeptide member of the transforming growth factor beta superfamily of cytokines. It is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. The TGFB1 protein helps control the growth and division (proliferation) of cells, the process by which cells mature to carry out specific functions (differentiation), cell movement (motility), and the self-destruction of cells (apoptosis). The TGFB1 protein is found throughout the body and plays a role in development before birth, the formation of blood vessels, the regulation of muscle tissue and body fat development, wound healing, and immune system function. TGFB1 is particularly abundant in tissues that make up the skeleton, where it helps regulate bone growth, and in the intricate lattice that forms in the spaces between cells (the extracellular matrix). Within cells, this protein is turned off (inactive) until it receives a chemical signal to become active. TGFB1 plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages. Most immune cells (or leukocytes) secrete TGFB1. TGFB1 has been shown to interact with TGF beta receptor 1, LTBP1, YWHAE, EIF3I and Decorin.


Supplier: Abcam
Description: Rabbit monoclonal [EPR19867] to TGF beta 1+TGF beta 3 - BSA and Azide free.

New Product

Catalog Number: (76116-664)
Supplier: Bioss
Description: Laminin S binds to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. Laminin S is a complex glycoprotein, consisting of three different polypeptide chains (alpha, beta, gamma), which are bound to each other by disulfide bonds into a cross-shaped molecule comprising one long and three short arms with globules at each end. Beta 2 is a subunit of laminin 3 (Laminin S), laminin 4 (S merosin), and laminin 7 (KS laminin).


Catalog Number: (75791-528)
Supplier: Prosci
Description: Human IL-2RB, also known asinterleukin-2 receptor subunit beta,is the receptor for interleukin-2. IL2 receptor complex is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. IL2 receptor complex has three forms with respect to ability to bind IL2. IL-2RB is belonged to a type I membrane protein,and has a 26 residue signal peptide, a 214 residue extracellular region, a 25 residue transmembrane region and a 286 residue cytoplasmic domain. IL-2RB is the subunit critical for receptor-mediated signaling via physically or functionally coupling to other signaling molecules, such as the Jak-STAT and Src-family protein tyrosine kinase although it lacks apparent catalytic motifs.


Catalog Number: (75791-530)
Supplier: Prosci
Description: Human IL-2RB, also known asinterleukin-2 receptor subunit beta,is the receptor for interleukin-2. IL2 receptor complex is involved in receptor mediated endocytosis and transduces the mitogenic signals of IL2. IL2 receptor complex has three forms with respect to ability to bind IL2. IL-2RB is belonged to a type I membrane protein,and has a 26 residue signal peptide, a 214 residue extracellular region, a 25 residue transmembrane region and a 286 residue cytoplasmic domain. IL-2RB is the subunit critical for receptor-mediated signaling via physically or functionally coupling to other signaling molecules, such as the Jak-STAT and Src-family protein tyrosine kinase although it lacks apparent catalytic motifs.


Catalog Number: (102877-058)
Supplier: R&D Systems
Description: The Recombinant Mouse IL-10 R beta Fc Chimera Protein from R&D Systems is derived from NS0. The Recombinant Mouse IL-10 R beta Fc Chimera Protein has been validated for the following applications: Bioactivity.


Catalog Number: (76078-792)
Supplier: Bioss
Description: Beta-defensins (also designated BD, and hBD in human) are small cationic peptides with broad-spectrum antimicrobial activity. Produced in mucosal epithelia and neutrophils of several species, Beta-defensins are developmentally regulated. Human b-defensin 2 is locally regulated by inflammation and is the first member of the b-defensin family that is locally inducible by inflammation. The murine homolog of human b-defensin 2, which is called b-defensin 3, is present in the respiratory system and in low levels in the epithelial cells of the intestine and lung. The unique murine b-defensin 2 (Defb2) is not expressed in airways of untreated mice, but is upregulated in the airways by lipopolysaccharide and may contribute to host defense at the mucosal surface of the airways.


Supplier: Anaspec Inc
Description: This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated Aβ(x–42) induced the phagocytosis of PSPs significantly more effectively than did Aβ(x–40).
Sequence: AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4399 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Catalog Number: (89262-242)
Supplier: Genetex
Description: Mouse Monoclonal antibody to Interleukin-1 Beta Clone: DF8 Species Reactivity: Pig Tested Applications: WB Pkg Size: 500 ug


Catalog Number: (76235-688)
Supplier: Rockland Immunochemical
Description: Rat CCL4 - MIP-1 beta AccuSignal ELISA Kit


Supplier: Abcam
Description: Rabbit monoclonal [EPR25742-21] to beta Arrestin 1 + Beta Arrestin 2 - BSA and Azide free (Capture).

New Product

Supplier: Bon Opus Biosciences
Description: Bon Opus Biosciences offers quality recombinant proteins products covering a broad collection of cytokines, enzymes, diagnostic and detection reagents, and other protein-related products

Catalog Number: (102869-040)
Supplier: R&D Systems
Description: The Recombinant Mouse Integrin alpha V beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha V beta 1 Protein has been validated for the following applications: Bioactivity.


Catalog Number: (103006-670)
Supplier: Anaspec Inc
Description: This b-amyloid (1-42) contains the Flemish (D23N) mutation where Asp23 is replaced by Asn.
Sequence: DAEFRHDSGYEVHHQKLVFFAENVGSNKGAIIGLMVGGVVIA
MW: 4513.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (75791-574)
Supplier: Prosci
Description: Human Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 3 (B3GAT3) is an enzyme that in humans is encoded by the B3GAT3 gene, belongs to the glycosyltransferase 43 family


Catalog Number: (103007-636)
Supplier: Anaspec Inc
Description: Substitution of Ser 26 with Cys in Aβ1-40 allows the generation of the covalently linked Aβ40 homodimer. Dimerization can be reverted by adding a reducing agent. This Cys-containing mutant can be used as a model for aggregation studies.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGCNKGAIIGLMVGGVV
Molecular Weight: 4345.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
433 - 448 of 19,814
no targeter for Bottom