You Searched For: beta-Cholestanol


19,814  results were found

SearchResultCount:"19814"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (10400-970)
Supplier: Bioss
Description: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.


Catalog Number: (103007-366)
Supplier: Anaspec Inc
Description: This is a modified beta-amyloid (1-42) peptide wherein at position 35, the methionine is in an oxidized state. The Methionine residue at position 35 has been shown to be responsible for the oxidative stress and neurotoxic properties both in vitro and in vivo. In addition, Aβ- bearing oxidized Met-35 is found in considerable amounts in post-mortem AD plaques and the accumulation of oxidized Met-35 seems to be related to reduced enzymatic reversal of methionine sulfoxide back to methionine observed in AD brains.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGL-M(O)-VGGVVIA
Molecular Weight: 4530.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (103007-346)
Supplier: Anaspec Inc
Description: This peptide is amino acids 17 to 28 fragment of beta-amyloid.
Sequence: LVFFAEDVGSNK
Molecular Weight: 1325.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (89265-394)
Supplier: Genetex
Description: Mouse Monoclonal antibody to CD8 Alpha/Beta Clone: vpg9 Species Reactivity: Cat Tested Applications: FACS Pkg Size: 100 test


Catalog Number: (102868-914)
Supplier: R&D Systems
Description: The Recombinant Rabbit IL-1 beta/IL-1F2 Protein from R&D Systems is derived from E. coli. The Recombinant Rabbit IL-1 beta/IL-1F2 Protein has been validated for the following applications: Bioactivity.


Catalog Number: (77053-558)
Supplier: ANTIBODIES.COM LLC
Description: Rabbit polyclonal antibody to TGF beta Receptor II (phospho Ser225 + Ser250) for IHC and ELISA with samples derived from Human and Mouse.


Catalog Number: (103007-212)
Supplier: Anaspec Inc
Description: This peptide is the mutant form of beta-Amyloid 1 to 40. These mutations within the beta-Amyloid precursor protein (APP) regions result in the substitution of glutamine for glutamic acid and asparagine for aspartic acid. The peptide rapidly assembles in solution to form fibrils compared to the wild-type beta-Amyloid 1 to 40. Double-mutant E22Q/D23N Dutch/Iowa beta-Amyloid 40 is more potent than either of the single mutant form in causing pathologic responses in culture cells. The double mutations further enhances the fibrillogenic and pathogenic properties of beta-Amyloid.
Sequence: DAEFRHDSGYEVHHQKLVFFAQNVGSNKGAIIGLMVGGVV
Molecular Weight: 4327.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (89286-620)
Supplier: Genetex
Description: Mouse Monoclonal antibody to TCR V beta 10 Clone: G101 Purity: Purified IgG Tested Applications: FACS Pkg Size: 250 ug


Supplier: ANTIBODIES.COM LLC
Description: Recombinant Human S100 beta

Catalog Number: (10400-972)
Supplier: Bioss
Description: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.


Catalog Number: (102869-078)
Supplier: R&D Systems
Description: The Recombinant Human TGF-beta 1 (Human Cell-expressed) Protein from R&D Systems is derived from HEK293. The Recombinant Human TGF-beta 1 (Human Cell-expressed) Protein has been validated for the following applications: Bioactivity.


Catalog Number: (10400-968)
Supplier: Bioss
Description: This gene encodes a member of the transforming growth factor beta (TGFB) family of cytokines, which are multifunctional peptides that regulate proliferation, differentiation, adhesion, migration, and other functions in many cell types. Many cells have TGFB receptors, and the protein positively and negatively regulates many other growth factors. The secreted protein is cleaved into a latency-associated peptide (LAP) and a mature TGFB1 peptide, and is found in either a latent form composed of a TGFB1 homodimer, a LAP homodimer, and a latent TGFB1-binding protein, or in an active form composed of a TGFB1 homodimer. The mature peptide may also form heterodimers with other TGFB family members. This gene is frequently upregulated in tumor cells, and mutations in this gene result in Camurati-Engelmann disease.


Catalog Number: (102869-146)
Supplier: R&D Systems
Description: The Recombinant Mouse Integrin alpha 10 beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha 10 beta 1 Protein has been validated for the following applications: Bioactivity.


Catalog Number: (102869-126)
Supplier: R&D Systems
Description: The Recombinant Mouse Integrin alpha 11 beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha 11 beta 1 Protein has been validated for the following applications: Bioactivity.


Catalog Number: (102869-236)
Supplier: R&D Systems
Description: The Recombinant Human Latent TGF-beta bp4 Protein from R&D Systems is derived from HEK293. The Recombinant Human Latent TGF-beta bp4 Protein has been validated for the following applications: Bioactivity.


Catalog Number: (89299-772)
Supplier: Genetex
Description: Mouse Monoclonal antibody to Estradiol-17-beta Clone: ESTR-1 Species Reactivity: Chemical Tested Applications: ELISA Pkg Size: 500 ug


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
593 - 608 of 19,814
no targeter for Bottom