Print…

You Searched For: ZnAF-1+DA


1,860  results were found

Refine Results Sort by
SearchResultCount:"1860"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-103008-004

[Lys(Me2)27]-Histone H3 (21-44)-GK(Biotin),Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 21 to 44 di-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me2)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103010-002

Human Protease Activated Receptor 1

Catalog Number: (103010-002)
Supplier: Anaspec Inc
Description: This peptide is PAR-1 selective agonist displaying a high level of specificity to PAR-1 over PAR-2. The specificity of peptide was evaluated in cell-based calcium signaling assay using HEK293 cells. PAR-1 selective agonists can be used to study PAR-1 activation in vivo.
Sequence: AF(para - Fluoro)R - Cha - Cit - Y - NH2
MW: 883 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-102996-492

Bovine Neurotensin

Supplier: Anaspec Inc
Description: This 13 amino acid peptide was first isolated from bovine hypothalamus and was named from its neuronal localization. It was detected in the central nervous system (CNS) and peripheral tissues mainly in the gastrointestinal tract. This bioactive form of neurotensin post-translationally modified at a Glu residue was isolated from porcine intestine.
Sequence:Pyr-LYENKPRRPYIL
MW:1673 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C

Image Unavailable-102999-360

[Lys3]-Bombesin

Catalog Number: (102999-360)
Supplier: Anaspec Inc
Description: PET (Positron Emission Tomography) imaging of [Lys3]-bombesin is able to detect gastrin-releasing peptide receptor (GRPR) positive prostate cancer. An immunoconjugate of [Lys3]-bombesin and corresponding monoclonal antibody can specifically induce (CD64)-dependent monocyte and neutrophil-mediated lysis of small cell carcinoma.
Sequence:Pyr-QKLGNQWAVGHLM-NH2
MW:1591.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103005-904

DNA-PK Substrate

Catalog Number: (103005-904)
Supplier: Anaspec Inc
Description: A substrate for DNA-dependent protein kinase (DNA-PK), phosphorylation. DNA-PK is essential for the repair of DNA double-strand breaks. This peptide corresponding to 11–24 amino acids of human p53 with threonine 18 and serine 20 changed to alanine is used as a substrate for the assay of DNA-PK activity
Sequence:EPPLSQEAFADLWKK
MW:1759 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-010

[Lys(Me3)27]-Histone H3 (21-44)-GK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 21 to 44 tri-methylated at Lys-27 with an addidtional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me3)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2959.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-002

[Lys(Me1)27]-Histone H3 (21-44)-GK,Biotin

Supplier: Anaspec Inc
Description: This peptide is Histone H3 amino acid residues 21 to 44 mono-methylated at Lys-27 with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAAR-K(Me1)-SAPATGGVKKPHRYRPG-GK(Biotin)
MW:2931.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Image Unavailable-103008-644

[Lys(Me3)12]-Histone H4(1-21)-GGK,Biotin

Catalog Number: (103008-644)
Supplier: Anaspec Inc
Description: This peptide is histone H4 amino acid residues 1 to 21. It is acetylated at the N-terminus, and trimethylated at Lys-12 with a C-terminal GG linker, followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:Ac-SGRGKGGKGLG-K(Me3)-GGAKRHRKV-GGK(Biotin)
MW:2644.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103009-488

[pSer28]-Histone H3 (21-44)-GK,Biotin

Catalog Number: (103009-488)
Supplier: Anaspec Inc
Description: This is histone H3 (21-44) phosphorylated at Ser28 with an additional C-terminal glycine followed by a biotinylated lysine. Phosphorylation of Ser28 occurs in prophase of mitosis and is associated with the initiation of chromosome condensation. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARK-pS-APATGGVKKPHRYRPG-GK(Biotin)
MW:2997.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-684

L. monocytogenes LLO190

Catalog Number: (103006-684)
Supplier: Anaspec Inc
Description: This peptide is a major histocompatibility complex class II (MHC-II)-restricted peptide, LLO190 (NEKYAQAYPNVS), from the listeriolysin O protein of Listeria monocytogenes, which generates an LLO190-specific Th response.
This peptide subsequently challenges recombinant L. monocytogenes expressing the MHC-I-restricted epitope of ovalbumin (Ova257, SIINFEKL).
Sequence:NEKYAQAYPNVS
MW:1383.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103006-482

Buforin

Catalog Number: (103006-482)
Supplier: Anaspec Inc
Description: This antimicrobial peptide interacts with phospholipid bilayers and can be efficiently translocated accross the layer with a weak membrane permeabilization activity. The proline hinge in Buforin 2 is responsible for these cell penetrating properties. This class of antibacterial peptides therefore targets intracellular molecules, most probably nucleic acids, without significantly permeting cell membranes.
Sequence:TRSSRAGLQFPVGRVHRLLRK
MW:2434.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-246

HIV TAT-NSF222scr Fusion Polypeptide

Catalog Number: (103007-246)
Supplier: Anaspec Inc
Description: This is a scrambled TAT-NSF222scr fusion polypeptide. It is composed of 11 amino acids from the cell permeable human immunodeficiency virus TAT polypeptide, 3 glycines as a linker, followed by scrambled N-Ethyl-maleimide-sensitive factor (NSF) D1 domain. This peptide is used as a control for the TAT-NSF222 peptide.
Sequence: YGRKKRRQRRR-GGG-ENSFRFLADIFPAKAFPVRFE
MW: 4214.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Image Unavailable-103006-556

Human LL-37 Peptide

Catalog Number: (103006-556)
Supplier: Anaspec Inc
Description: Antimicrobial peptide LL-37,  belongs  to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human.  It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds.  Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution. 
Sequence: [LL-37, 37 aa]
MW: 4493.3 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-103007-414

Drosophila melanogaster Drosocin

Catalog Number: (103007-414)
Supplier: Anaspec Inc
Description: Drosocin is a 19-mer cationic antimicrobial peptide from Drosophila melanogaster. In Drosophila native drosocin carries a disaccharide moiety attached to a threonine residue in mid-chain position. This synthetic drosocin peptide of identical amino acid sequence without the disaccharide has an activity several times lower than the native compound.
Sequence:GKPRPYSPRPTSHPRPIRV
MW:2198.6 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-312

Honey bee Melittin

Catalog Number: (103007-312)
Supplier: Anaspec Inc
Description: Melittin, a 26-residue bee venom peptide, is known to induce murine antibodies specific for its hydrophilic C-terminus of residues 20 to 26 and T-cell responses specific for its hydrophobic mid-region (residue 11 to 19). This peptide is an anti-inflammatory agent, it inhibits the lyme disease spirochete.
Sequence:GIGAVLKVLTTGLPALISWIKRKRQQ-NH2
MW:2846.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103008-578

Penetratin

Catalog Number: (103008-578)
Supplier: Anaspec Inc
Description: Penetratin is a cell-penetrating peptide (CPP), also known as a protein transduction domain (PTD), of which the first 16 amino acids are derived from the third helix of the Antennapedia protein homeodomain. Penetratin linked to a phosphodiester oligonucleotide is capable of permeating through neuronal cell membranes and down-regulating genes.
Sequence:RQIKIWFQNRRMKWKKGG
MW:2360.9 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
657 - 672 of 1,860
no targeter for Bottom