You Searched For: Z-Asn-OMe


892  results were found

SearchResultCount:"892"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: Sequence: H-Glu-OMe

Catalog Number: (103871-640)
Supplier: ACROBIOSYSTEMS INC MS
Description: Biotinylated Human CD36 / SR-B3 Protein, His,Avitag™, ACROBiosystems


Supplier: Bachem Americas
Description: Sequence: H-His-OMe · 2 HCl

Supplier: Bachem Americas
Description: This fluorogenic HIV-1 protease substrate consists of an octapeptide with a fluorescent donor (EDANS) and a quenching acceptor (DABCYL), attached at the COOH- and NH₂-termini. The γ-Abu spacer was inserted to avoid potential steric hindrance of substrate binding by the bulky acceptor. This FRET substrate is cleaved by the HIV-1 protease at the Tyr-Pro bond which results in a time-dependent increase in fluorescence intensity; excitation at 340 nm, emission at 490 nm.

Catalog Number: (10454-972)
Supplier: Bioss
Description: Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.


Catalog Number: (10454-962)
Supplier: Bioss
Description: Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.


Catalog Number: (10059-318)
Supplier: Restek
Description: For use with Agilent 7673, 7683, 7693A, and 6850 autosamplers.


Supplier: Bachem Americas
Description: Sequence: H-His(1-Trt)-OMe · HCl

Supplier: Bachem Americas
Description: Sequence: H-Lys-OMe · 2 HCl

Supplier: Thermo Scientific Chemicals
Description: White to off-white
Catalog Number: (AAH63993-06)
Supplier: Thermo Scientific Chemicals
Description: N-Benzyloxycarbonyl-4-trans-hydroxy-L-proline methyl ester, 98%

Supplier: Bachem Americas
Description: Methyl ester of Z-VDVAD-FMK. This cell-permeable fluoromethylketone inhibits specifically caspase-2 and, to a lesser degree, caspase-3 and caspase-7.

Supplier: Bachem Americas
Description: This specific caspase-3 inhibitor reduces vulnerability to the neuronal death that occurs in the aftermath of kainic acid-evoked status epilepticus (SE).

Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (H-1780.0005BA)
Supplier: Bachem Americas
Description: The major physiological roles of AVP are regulation of water balance in animals (antidiuretic action) and contraction of arterioles (vasopressor action).
Synonym: AVP, Argipressin, (Phe3,Arg8)-Oxytocin, Pitressin, Leiormone, Arginine Antidiuretic Hormone
Sequence: H-Cys-Tyr-Phe-Gln-Asn-Cys-Pro-Arg-Gly-NH2
Salt: Trifluoroacetate
Bonds: (Disulfide bond)


Catalog Number: (89146-760)
Supplier: Enzo Life Sciences
Description: Caspase-9 inhibitor


Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
177 - 192 of 892
no targeter for Bottom