You Searched For: Sulfo-NHS-LC-Biotin


19,996  results were found

SearchResultCount:"19996"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Avantor Performance Materials
Description: Suitable for bioprocessing. BSE/TSE free. Endotoxin tested. Custom packaging and testing available. Change management and notification available. Samples available.
Supplier: VWR
Description: Reagent for stabilization of buffer formulations and electrophoresis of biological molecules.
Catalog Number: (103007-676)
Supplier: Anaspec Inc
Description: This is antimicrobial peptide LL-37 with a 6-carbon linker (LC) conjugated to 5-FAM suitable for cell culture and activity studies.
Sequence: 5 - FAM - LC - [LL-37, 37 aa]
MW: 4964.9 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: TCI America
Description: [Ion-Pair Reagent for LC-MS]
CAS Number: 366793-17-1
MDL Number: MFCD03093619
Molecular Formula: C14H31NO2
Molecular Weight: 245.41
Form: Clear Liquid
Color: Colorless
Specific Gravity (20/20): 1.00
Supplier: Thermo Scientific
Description: The NHS-Azide and NHS-Phosphine Reagents are amine-reactive compounds for derivatising primary amines of proteins or amine-coated polymer surfaces. Once a protein or surface is azide- or phosphine-labelled, the two components are mixed for effective and stable conjugation. Phosphine groups react with azides via a Staudinger reaction to produce an aza-ylide intermediate that is trapped to form a stable, covalent amide bond. Because phosphines and azides are absent from biological systems, there is minimal background labelling of macromolecules found in cells or lysates.
Supplier: CUBE BIOTECH
Description: PureCube NHS (N-hydroxy succinimide) MagBeads/magnetic beads are your best option to couple biomolecules with free-standing amine groups.

Catalog Number: (75834-884)
Supplier: Restek
Description: Accurately detect and quantify pesticides of global food safety concern in a wide range of fruits, vegetables, and other commodities by LC-MS/MS.


Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: Crystals. For liquid chromatography and molecular biology applications. Lot analysis on label.
Catalog Number: (75834-894)
Supplier: Restek
Description: Accurately detect and quantify pesticides of global food safety concern in a wide range of fruits, vegetables, and other commodities by LC-MS/MS.

Supplier: Thermo Scientific
Description: Resolve polar and non-polar compounds in a single run with Thermo Scientific™ Acclaim PolarAdvantage II (PA2) reversed-phase columns.

Catalog Number: (75834-890)
Supplier: Restek
Description: Accurately detect and quantify pesticides of global food safety concern in a wide range of fruits, vegetables, and other commodities by LC-MS/MS.

Supplier: Thermo Scientific
Description: Separate water-soluble polymers and oligomers with Thermo Scientific™ Acclaim™ SEC LC Columns.

Catalog Number: (SXLCS-5783)
Supplier: SPEX CERTIPREP LLC
Description: LC & LC/MS single-component organic standard.


Supplier: Thermo Scientific Chemicals
Description: Hydrazine Hydrate used as a reactant in the cyclizations of pyridinones. It is also used in the study of nanocrystal semiconductors, participating in the functionalization and passivation of surface states.
Catalog Number: (RCR2584000120C)
Supplier: Ricca Chemical
Description: Diphenylamine 1% (w/v) in sulphuric acid

Supplier: Trajan Scientific and Medical
Description: SGE HPLC Unions are specifically designed and precision engineered for use in capillary LC

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
513 - 528 of 19,996
no targeter for Bottom