You Searched For: Rink+amide+AM+resin


4,013  results were found

SearchResultCount:"4013"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: Substitution 0.50-0.90 mmol/g Storage Conditions -20 +/- 5 Deg C 1g

Supplier: Thermo Scientific
Description: Thermo Scientific Pierce Fab Micro Preparation Kit uses immobilized papain protease to digest human or mouse IgG antibodies to make separate Fab and Fc fragments and subsequently to purify the Fab using Protein A agarose.
Supplier: Bachem Americas
Description: The peptide CDPGYIGSR amide, which comprises residues 925-933 of the laminin B1 chain, inhibited both angiogenesis and solid tumor growth.

Supplier: Thermo Scientific Chemicals
Description: Water softening, dealkalinization, deionization

Fieser: 1,511 4,266 5,355 6,302 9,256
Catalog Number: (CA5041-2191)
Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Description: Tubing and Fittings are designed for 8453 and 8454 UV-Vis Instruments and Accessories.


Catalog Number: (470237-664)
Supplier: Avantor
Description: This species of very large predatory fish swam the oceans of the Late Cretaceous some 90 million years ago.


Supplier: Bachem Americas
Description: For the long-acting GLP-1 analog liraglutide see H-6724.

Supplier: Chemglass
Description: Thread Size: 15-425; Liner Type: fluoropolymer resin. Cap for use with CG-190 G.P.I. screw thread tube. Part numbers CG-191-01 through CG-191-12 are made of black plastic with a choice of white rubber or fluoropolymer resin liner.

Small Business Enterprise

Supplier: Avantor
Description: Avantor® ACE® Method Development Kits (MDK) are designed to maximise selectivity, offering a powerful and reliable approach to UHPLC/HPLC method development. Based upon an ultra-inert, high efficiency silica, Avantor® ACE® phases incorporate the latest developments in LC stationary phase design, providing chromatographers with more choices for alternative selectivity, without compromising stability or robustness.

Environmentally Preferable

Catalog Number: (470237-644)
Supplier: Avantor
Description: Dramatically preserved assemblage of 24 complete trilobites showing exceptional detail on a 13×15" matrix. Ohio.


Supplier: Bachem Americas
Description: Substitution 0.50-0.90 mmol/g Storage Conditions -20 +/- 5 Deg C 5g

Catalog Number: (60986-080)
Supplier: Thermo Fisher Scientific
Description: Securely hold 0.5 or 1.5mL microcentrifuge tubes


Supplier: Thermo Fisher Scientific
Description: These racks are ideal for applications using 36 tubes or less

Environmentally Preferable

Supplier: Bachem Americas
Description: Substitution 0.50-0.90 mmol/g Storage Conditions -20 +/- 5 Deg C 5G

Catalog Number: (103003-156)
Supplier: Anaspec Inc
Description: AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C


Supplier: W.R. GRACE & CO. - CONN
Description: Unique Wide Pore and Extra-Wide Pore silicas are a cost effective solution for purification of large molecules.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
929 - 944 of 4,013
no targeter for Bottom