Print…

You Searched For: Nepsilon-acetyl-L-lysine


4,187  results were found

Refine Results Sort by
SearchResultCount:"4187"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-CAAAA15409-22

N-Acetyl-L-cysteine 98+%

Supplier: Thermo Scientific Chemicals
Description: A mucolytic agent for isolation of mycobacteria from sputum

Certificates

Image Unavailable-CAAAAL19362-03

3-Acetyl-5-bromopyridine 97%

Supplier: Thermo Scientific Chemicals
Description: 3-Acetyl-5-bromopyridine 97%

Certificates

Image Unavailable-103007-756

Histone H3 (1-21), FAM (Carboxyfluorescein)

Catalog Number: (103007-756)
Supplier: Anaspec Inc
Description: This sequence corresponds to the first 21 amino acids of the NH2 terminal of histone H3 followed by a GG linker and a FAM (Abs/Em = 494/521 nm) labeled lysine.
Sequence:ARTKQTARKSTGGKAPRKQLA-GGK(FAM)-NH2
MW:2854.2 Da
% peak area by HPLC:95
Storage condition:-20° C
Product Image-77664-334

FluoroDish Cell Culture Dishes

Catalog Number: (77664-334)
Supplier: WORLD PRECISION INSTRUMENTS LLC
Description: <p>Coated FluoroDish™ used to improve cell adhesion, growth, and differentiation.</p>

New Product


Product Image-10094-566

Anti-SMYD3 Rabbit Polyclonal Antibody

Catalog Number: (10094-566)
Supplier: Proteintech
Description: SMYD3,also name as ZMYND1 and ZNFN3A1, belongs to the histone-lysine methyltransferase family.It is a histone methyltransferase that plays an important role in transcriptional regulation in human carcinogenesis. It can specifically methylate histone H3 at lysine 4 and activate the transcription of a set of downstream genes, including several oncogenes (e.g., N-myc, CrkL, Wnt10b, RIZ and hTERT) and genes involved in the control of cell cycle.. It plays an important role in transcriptional activation as a member of an RNA polymerase complex. SMYD3 is frequently overexpressed in different types of cancer cells. It functions as a coactivator of Era and potentiates Era activity in response to ligand. SMYD3 as a new coactivator for ER-mediated transcription, providing a possible link between SMYD3 overexpression and breast cancer. The common variable number of tandem repeats polymorphism in SMYD3 is a susceptibility factor for some types of human cancer. .
Image Unavailable-CAAAAL10563-MD

2-Acetyl-3-aminothiophene 97%

Supplier: Thermo Scientific Chemicals
Description: 2-Acetyl-3-aminothiophene 97%

Certificates

Image Unavailable-CA8.22252.0100

Acetyl chloride for synthesis, Sigma-Aldrich®

Catalog Number: (CA8.22252.0100)
Supplier: MilliporeSigma
Description: Cas Number 75-36-5, For Synthesis

SDS Certificates


Image Unavailable-CA10816-734

Anti-HIST1H3A Mouse Monoclonal Antibody [clone: 9B1-2G6]

Catalog Number: (CA10816-734)
Supplier: Biolegend
Description: Histone H3 Nonmethyl (Lys9), Monoclonal antibody, clone: 9B1-2G6, host: Mouse, Reactivity: Human, Isotype: IgG1,kappa, Immunogen: against a synthetic peptide from Human Histone H3, non-methylated at Lysine-9, Conjugate: purified, Size: 100 ul
Image Unavailable-TCA2049-1G

(R)-1-Acetyl-3-pyrrolidinol ≥98.0%

Catalog Number: (TCA2049-1G)
Supplier: TCI America
Description: CAS Number: 916733-17-0
Molecular Formula: C6H11NO2
Molecular Weight: 129.16
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 83
Specific rotation [a]20/D: -42 deg (C=3, MeOH)

SDS


Image Unavailable-103009-604

Histone H4 (8-30)-WGK

Catalog Number: (103009-604)
Supplier: Anaspec Inc
Description: This peptide is Histone H4 amino acid residues 8-30 with a C-terminal WG linker followed by a biotinylated lysine.
Sequence:Ac-KGLGKGGAKRHRKVLRDNIQGIT-WGK(biotin)
MW:3142.7 Da
% peak area by HPLC:95
Storage condition:-20° C
Image Unavailable-103007-358

Human Beta-Amyloid (1-28)-Lys(Biotin)-NH2, Biotin

Catalog Number: (103007-358)
Supplier: Anaspec Inc
Description: This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Image Unavailable-CAAAAL14103-14

Tri-O-acetyl-D-glucal 98%

Catalog Number: (CAAAAL14103-14)
Supplier: Thermo Scientific Chemicals
Description: Tri-O-acetyl-D-glucal 98%

Certificates


Image Unavailable-E-1005.0250BA

N-Acetyl-L-alanine

Supplier: Bachem Americas
Description: Sequence: Ac-Ala-OH

Image Unavailable-CAAAA14666-14

6-Acetyl-1,2,3,4-tetrahydronaphthalene 97%

Supplier: Thermo Scientific Chemicals
Description: 6-Acetyl-1,2,3,4-tetrahydronaphthalene 97%

Certificates

Image Unavailable-10480-466

Anti-DHPS Rabbit Polyclonal Antibody (FITC (Fluorescein Isothiocyanate))

Catalog Number: (10480-466)
Supplier: Bioss
Description: Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.
Image Unavailable-CA10816-970

Anti-HIST1H4A Mouse Monoclonal Antibody [clone: 6F8-D9]

Catalog Number: (CA10816-970)
Supplier: Biolegend
Description: Histone H4 Trimethyl (Lys 20) Monoclonal Antibody, Clone: [6F8-D9], Host: Mouse, Reactivity: Human, Isotype: IgG1, Immunogen:  synthetic peptide conjugated to KLH containing trimethylated lysine 20, Conjugate: Purified, Synonymn: Histone H4, Size: 100ul
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
545 - 560 of 4,187
no targeter for Bottom