You Searched For: Nepsilon-acetyl-L-lysine

Catalog Number: (10347-996)

Supplier: Bioss

Description: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.

Supplier: Anaspec Inc

Description: This is a Histone 3 lysine 36 dimethylated peptide. This peptide has been shown to recruit histone deacetylase complex with nucleosomes and repress transcription. In addition, owing to its epigenetic repressive mark, it allows demethylation by a Jumonji C-domain family member, JMJD5 that functions as a transcription activator by inhibiting HDAC, and regulates cell cycle proliferation.
Sequence:ATKAARKSAPATGGV-K(Me2)-KPHRYRPG-GK(Biotin)
MW:2945.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (75789-494)

Supplier: Prosci

Description: C-Type Lectin Domain Family 3 Member B (CLEC3B) is a serum and tissue protein and it contais a C-type lectin which binds to Ca++. CLEC3B is originally found in plasma, the concentrations approximately 10mg/l. It can bind to kringle 4 of plasminogen and enhance the activation of plaminogen to plasmin, catalyzed by tissue plasminogen activator in the presence of poly-D-lysine. In addition, CLEC3B may be involved in the packaging of molecules destined for exocytosis. Also, CLEC3B is best known as a prognostic marker in ovarian cancer.

Catalog Number: (103008-150)

Supplier: Anaspec Inc

Description: EMP17 is an erythropoietin (EPO)-mimetic peptide. Erythropoietin (EPO) is the hormone involved in red blood cell production, which activates its receptor by binding to the receptor's extracellular domain and presumably dimerizing two receptor monomers to initiate signal transduction. EMP contains two potentially reactive amines, one at the amino terminus of the peptide and one in the side chain of the single lysine within the peptide sequence.
Sequence: TYSCHFGPLTWVCKPQGG
MW: 1981.3 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (10348-000)

Supplier: Bioss

Description: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes.

Catalog Number: (10094-412)

Supplier: Proteintech

Description: SIRT5, a member fo sirtuin family that is a mitochondrial matrix NAD(+)-dependent deacetylase and mono-ADP-ribosyltransferases. Sirtuins play important role in various cellular processed, such as aging, gene silencing and metabolism. SIRT5 mainly locates in . It is an efficient protein lysine desuccinylase and demalonylase. During prolonged fasting, it can activate CPS1, the committed and regulated enzyme of the urea cycle, and contribute to the regulation of blood ammonia levels.

Catalog Number: (102996-408)

Supplier: Anaspec Inc

Description: This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (10107-502)

Supplier: Prosci

Description: HMG20A plays a role in neuronal differentiation as chromatin-associated protein. HMG20A acts as inhibitor of HMG20B. HMG20A overcomes the repressive effects of the neuronal silencer REST and induces the activation of neuronal-specific genes. HMG20A involved in the recruitment of the histone methyltransferase MLL and consequent increased methylation of histone H3 lysine 4

Catalog Number: (102998-700)

Supplier: Anaspec Inc

Description: Multiple Antigenic Peptides (MAPs) are synthetic peptides with 4 branches harboring 2 Lysines each. The Lys residues are used as a scaffold to support 8 peptides. MAPs are used to increase the mass of the peptide entity when used as antigen in immunizations. They represent an alternative to carrier proteins, such as BSA or KLH.
Sequence:K4K2KA - NH2
MW:985.3 Da
% peak area by HPLC:95
Storage condition:-20° C

Catalog Number: (10480-464)

Supplier: Bioss

Description: Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue.

Catalog Number: (CA1.05290.0500)

Supplier: MilliporeSigma

Description: According to Harmonized USP/EP/JP. 500g.

SDS Certificates

Catalog Number: (CA10816-730)

Supplier: Biolegend

Description: Histone H3 Dimethyl (Lys9), Monoclonal antibody, clone: 5E5-G5, host: Mouse, Reactivity: Human, Rat, Isotype: IgG1, Immunogen: against a synthetic peptide from Human Histone H3, di-methylated at Lysine-9, Conjugate: purified, Size: 100 ul

Catalog Number: (103008-388)

Supplier: Anaspec Inc

Description: This peptide is Histone H3 (21-44) with an additional C-terminal glycine followed by a biotinylated lysine. Provided at >95% peptide purity, this peptide was dissolved in distilled water at 1 mg/ml and re-lyophilized to powder form.
Sequence:ATKAARKSAPSTGGVKKPHRYRPG-GK(Biotin)-NH2
MW:2932.5 Da
% peak area by HPLC:95
Storage condition:-20° C

Supplier: Thermo Scientific Chemicals

Description: Powder

Certificates

Supplier: Thermo Scientific Chemicals

Description: Acetyl bromide 98+%

Certificates

Catalog Number: (89416-004)

Supplier: Prosci

Description: LSD1 Antibody: Histone modifications mediate changes in gene expression by altering chromatin structure or by serving as a platform to recruit other proteins. LSD1 is a recently discovered amine oxidase that catalyzes the lysine-specific demethylation of histone proteins via an FAD-dependent oxidative reaction. Methylation on histone H3-K9 is thought to play an important role in heterochromatin formation, while methylation on arginine and some lysine residues (such as H3-K4) is associated with active transcription. LSD1 associates with various proteins, including HDAC1/2, CoREST, and BHC80, that act to regulate LSD1 activity in vivo, and in a histone H3-K4-specific methylase complex that is involved in transcriptional regulation. Experiments have shown that CoREST, a SANT domain-containing corepressor acts to enhance LSD1 activity, while BHC80, a PHD domain-containing protein, inhibits CoREST/LSD1 activity in vitro. LSD1-mediated histone demethylation thus may have significant effects on gene expression.