Print…

You Searched For: Molecular+sieve+A5+(0.5+nm,+5+\u00C5)


78,272  results were found

Refine Results Sort by
SearchResultCount:"78272"

Sort Results

List View Easy View

Rate These Search Results

Image Unavailable-TCT1489-025G

Thioindigo

Catalog Number: (TCT1489-025G)
Supplier: TCI America
Description: CAS Number: 522-75-8
MDL Number: MFCD00191692
Molecular Formula: C16H8O2S2
Molecular Weight: 296.36
Form: Crystal
Color: Deep Red
Melting point (°C): 280
Lambda max.: 543 nm (Toluene)

SDS Certificates


Image Unavailable-TCS0113-025G

Sudan black B

Catalog Number: (TCS0113-025G)
Supplier: TCI America
Description: CAS Number: 4197-25-5
MDL Number: MFCD00006919
Molecular Formula: C29H24N6
Molecular Weight: 456.55
Form: Crystal
Color: Deep Yellow Red
Melting point (°C): 124
Lambda max.: 600 nm (EtOH)

SDS Certificates


Image Unavailable-TCT2269-5G

N,N,N',N'-Tetrakis(p-tolyl)benzidine 98,0

Catalog Number: (TCT2269-5G)
Supplier: TCI America
Description: CAS Number: 76185-65-4
MDL Number: MFCD00799300
Molecular Formula: C40H36N2
Molecular Weight: 544.74
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Color: White
Melting point (°C): 218
Lambda max.: 355 nm (CH2Cl2)

SDS


Image Unavailable-TCD4361-1G

2,4-Dihydroxy-6-methylpyridine ≥98.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 3749-51-7
MDL Number: MFCD01860849
Molecular Formula: C6H7NO2
Molecular Weight: 125.13
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 330
Lambda max.: 282 nm (EtOH)

SDS Certificates

Image Unavailable-TCE1017-200MG

Ethyl-7-hydroxycoumarin-3-carboxylate ≥98.0% (by GC)

Catalog Number: (TCE1017-200MG)
Supplier: TCI America
Description: CAS Number: 6093-71-6
MDL Number: MFCD00017641
Molecular Formula: C12H10O5
Molecular Weight: 234.21
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 172
Lambda max.: 398 nm (EtOH)Storage Temperature: <0°C

SDS


Image Unavailable-TCA2590-1G

ɑ-Asarone ≥98.0% (by GC)

Supplier: TCI America
Description: CAS Number: 2883-98-9
MDL Number: MFCD00064457
Molecular Formula: C12H16O3
Molecular Weight: 208.26
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Boiling point (°C): 298
Melting point (°C): 61
Lambda max.: 312 nm (EtOH)

SDS

Image Unavailable-TCP1924-100MG

Pterostilbene 98,0

Supplier: TCI America
Description: CAS Number: 537-42-8
MDL Number: MFCD00238710
Molecular Formula: C16H16O3
Molecular Weight: 256.30
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Lambda max.: 321 nm (MeOH)Storage Temperature: 0-10°C

SDS Certificates

Image Unavailable-TCB4349-5G

Bergenin ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 477-90-7
MDL Number: MFCD00133120
Molecular Formula: C14H16O9
Molecular Weight: 328.27
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 240
Specific rotation [a]20/D: -39 deg (C=2, MeOH)
Lambda max.: 277 nm (EtOH)Storage Temperature: 0-10°C

SDS

Image Unavailable-TCT2644-1G

1,3,5-Tris(4-bromophenyl)benzene ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 7511-49-1
MDL Number: MFCD00362911
Molecular Formula: C24H15Br3
Molecular Weight: 543.10
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Color: White
Melting point (°C): 263
Lambda max.: 288 nm (CHCl3)

SDS Certificates

Image Unavailable-TCP2179-5G

Pentafluorophenyl acrylate 98,0

Supplier: TCI America
Description: CAS Number: 71195-85-2
MDL Number: MFCD00042330
Molecular Formula: C9H3F5O2
Molecular Weight: 238.11
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 197
Flash Point (°C): 68
Specific Gravity (20/20): 1.46
Lambda max.: 256 nm (Hexane)Storage Temperature: 0-10°C

SDS Certificates

Image Unavailable-TCA2699-100MG

4-Amino-6-hydroxypyrazolo[3,4-d]pyrimidine ≥93.0% (by HPLC)

Catalog Number: (TCA2699-100MG)
Supplier: TCI America
Description: CAS Number: 5472-41-3
MDL Number: MFCD00005689
Molecular Formula: C5H5N5O
Molecular Weight: 151.13
Purity/Analysis Method: >93.0% (HPLC)
Form: Crystal
Lambda max.: 250 nm (H2O)

SDS


Image Unavailable-TCC2858-1G

Coumarin 153 ≥98.0% (by HPLC)

Supplier: TCI America
Description: CAS Number: 53518-18-6
MDL Number: MFCD00041843
Molecular Formula: C16H14F3NO2
Molecular Weight: 309.29
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 166
Lambda max.: 426 nm (H2O)

SDS Certificates

Image Unavailable-TCC2899-200MG

Coumarin 343

Catalog Number: (TCC2899-200MG)
Supplier: TCI America
Description: CAS Number: 55804-65-4
MDL Number: MFCD00051335
Molecular Formula: C16H15NO4
Molecular Weight: 285.30
Form: Crystal
Color: Yellow
Melting point (°C): 235
Lambda max.: 446 nm (EtOH)

SDS


Image Unavailable-TCD4654-25G

1,3-Dimethylimidazolium iodide ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: CAS Number: 4333-62-4
MDL Number: MFCD00159685
Molecular Formula: C5H9IN2
Molecular Weight: 224.05
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 86
Lambda max.: 226 nm

SDS Certificates

Image Unavailable-TCM2494-1G

1-Methyl-1H-pyrazole-5-carboxylic acid ≥97.0% (by GC, titration analysis)

Supplier: TCI America
Description: CAS Number: 16034-46-1
MDL Number: MFCD00464253
Molecular Formula: C5H6N2O2
Molecular Weight: 126.12
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 225
Lambda max.: 259 nm (MeOH)

SDS

Image Unavailable-103003-174

Human Beta-Amyloid (1-40), TAMRA (5-Carboxytetramethylrhodamin)

Catalog Number: (103003-174)
Supplier: Anaspec Inc
Description: Fluorescent (TAMRA)-labeled ß-Amyloid peptides. Abs/Em=544/572 nm.
Sequence: TAMRA-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4742.4 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
337 - 352 of 78,272
no targeter for Bottom