You Searched For: Heat+Stress+Meters


9,297  results were found

SearchResultCount:"9297"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Fisher Scientific
Description: <p>The Thermo Scientific™ Orion™ Pro Star EC212 conductivity bench meter is designed to provide accurate, reliable electrochemistry testing. Featuring an intuitive interface, enhanced data reporting and robust functionality, the Orion™ Pro Star EC212 meter delivers advanced performance in a modern and simplified package.</p>

New Product

Catalog Number: (76221-212)
Supplier: Antyila Scientific
Description: Microprocessor based pH 700 benchtop meter measures pH, mV, relative mV, and temperature.

Catalog Number: (470017-306)
Supplier: MILWAUKEE INSTRUMENTS, INC.
Description: Determine How Many Particulates are in the Stream


Catalog Number: (470310-230)
Supplier: NEW GENIE GROUP INC SE
Description: The DO600-K is a convenient kit which adds versatility for measuring dissolved oxygen in laboratories or out in the field with a 16' (5 m) extension cable and probe weight guard for taking easy measurements in tanks or streams.


Catalog Number: (12620-972)
Supplier: VWR International
Description: The economical and durable Dyla-Dual™ hot plate stirrer is ideal for general heating and stirring.

UL Listed CE Compliant Product available on GSA Advantage®


Supplier: Mettler Toledo
Description: The pH/conductivity meter SevenDirect™ SD23 provides accurate pH and conductivity measurements for almost any sample across a wide range of applications. The EasyPlace electrode arm and protective cover are included with the instrument. The benchtop meter's ease of use, data handling options and robustness make it ideal for all industries.

Catalog Number: (82027-602)
Supplier: VWR International
Description: Constructed of heat-treated stainless steel, these scissors are great for home projects and general use.


Supplier: Mettler Toledo
Description: Accessories for SevenDirect™ pH/Ion Meter/Conductivity Meter

Supplier: Bachem Americas
Description: CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Supplier: Antyila Scientific

Supplier: Thermo Fisher Scientific
Description: Accurately monitor pH, ion concentration, mV, ORP and temperature on two channels with the ORION™ Dual Star™ Benchtop Meter for advanced laboratory analysis.

CSA Certified

Catalog Number: (89415-780)
Supplier: Prosci
Description: Caspase-2 Antibody: Caspases are a family of cysteine proteases that can be divided into the apoptotic and inflammatory caspase subfamilies. Unlike the apoptotic caspases, members of the inflammatory subfamily are generally not involved in cell death but are associated with the immune response to microbial pathogens. Members of this subfamily include caspase-1, -4, -5, and -12 and can activate proinflammatory cytokines such as IL-1 beta and IL-18. Although phylogenetically similar to this subfamily, Caspase-2 is thought to be involved in stress-induced apoptosis. Caspase-2 has two major isoforms; overexpression on the long form results in apoptosis while that of the short form suppresses cell death.


Supplier: VWR International
Description: These heat-transfer fluids provide superior thermal stability for high or low temperatures.

Product available on GSA Advantage®

Catalog Number: (CA89261-058)
Supplier: Mettler Toledo
Description: The SevenExcellence pH/Ion/conductivity meter combines three meters in one, with the flexibility to measure pH, Ion concentration and conductivity.


Supplier: VWR International
Description: The flasks come with uniform wall thickness which makes these flasks ideal for heating.
Supplier: AGILENT TECHNOLOGIES, INC (CSD) CA
Description: Battery-powered and portable flow meter for measuring gas streams with changing composition.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
641 - 656 of 9,297
no targeter for Bottom