Human;Rat CRF Acetate

Supplier: BACHEM AMERICAS INC

4011473.0001 4011473.0005
H-2435.0001BAEA 882.6 CAD
H-2435.0001BA H-2435.0005BA
Human;Rat CRF Acetate
Proteins and Peptides

CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.

Order Now


Learn more

About VWR

Avantor is a vertically integrated, global supplier of discovery-to-delivery solutions for...

Learn more About VWR