You Searched For: Isobornyl+acetate


2,891  results were found

SearchResultCount:"2891"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Ward's Science
Description: CAS Number: 141-78-6
Formula Weight: 88.11
Formula: CH3COOC2H5
Hazard Info: Flammable, Explosive, Irritant
Density (g/mL): 0.902
Boiling Point (°C): 77
Freezing Point (°C): -83.6
Solubility: Common Organic Solvents and Slightly in Water
Synonyms: Ethyl Acetic Ester
Shelf Life (months): 36
Storage: Red

SDS

Catalog Number: (470302-042)
Supplier: Ward's Science
Description: CAS Number: 127-08-2
Formula Weight: 98.14
Formula: CH3COOK
Density (g/mL): 1.57-1.8
Freezing Point (°C): 292
Solubility: Water
Synonyms: Acetic Acid Potassium Salt
Shelf Life (months): 36
Storage: Green

SDS


Catalog Number: (470302-368)
Supplier: Ward's Science
Description: CAS Number: 563-63-3
Formula: CH3COOAg
Density: 3.259 g/mL
Solubility: Hot Water and Nitric Acid
Synonyms: Argentous Acetate
Shelf Life: 36 Months

SDS


Supplier: Electron Microscopy Sciences
Description: Highly purified nitrocellulose (parlodion strip) in glass distilled amyl acetate. Useful for forming a negative replica to very fine detail.
Two types are available in range Electron Microscopy Sciences: Sterile formula which is filtered down to 0.45 micron and our non-sterile formula.
We are now offering Collodion (Parlodian) in a 30 ml bottle to avoid its classification as a hazardous chemical for shipping purposes.

Minority or Woman-Owned Business Enterprise

Catalog Number: (CA470300-052)
Supplier: ALDON CORP SE CA
Description: CAS Number: 108-24-7
Formula Weight: 102.09
Formula: C4H6O3
Hazard Info: Irritant, Corrosive, Flammable
Density (g/mL): 1.08
Boiling Point (°C): 139.9
Freezing Point (°C): -73
Solubility: Reacts with Water and Alcohol
Synonyms: Acetic Oxide, Acetyl Oxide, Ethanoic Anhydride, Acetic Acid Anhydride
Shelf Life (months): 36
Storage: White


Catalog Number: (TCA1535-001G)
Supplier: TCI America
Description: [Reagent for double aldol reaction]
CAS Number: 240423-53-4
MDL Number: MFCD02093425
Molecular Formula: C27H31NO4S
Molecular Weight: 465.61
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 121

SDS


Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: Ricca Chemical
Description: Acetate buffer, pH 4.0, for residual chlorine analysis
Supplier: Sartorius
Description: Cellulose Acetate (CA) membrane filters are highly suited for pressure filtration devices.

Catalog Number: (IC0976401C2)
Supplier: MP Biomedicals
Description: Acetate plate sealer is easy to apply and remove from microplates. In addition, this microplate sealing tape is suitable for all microplates for both short and long term storage, providing a tight seal to minimize evaporation and condensation.

Supplier: Cytiva
Description: Cytiva's Whatman cellulose acetate membrane filters have very low protein binding, which minimizes sample loss when filtering protein-based aqueous samples.
Catalog Number: (CA14909-32)
Supplier: Hach
Description: Acetate Buffer Solution, pH 4.0


Catalog Number: (TCA1534-001G)
Supplier: TCI America
Description: [Reagent for double aldol reaction]
CAS Number: 240423-74-9
MDL Number: MFCD02093424
Molecular Formula: C27H31NO4S
Molecular Weight: 465.61
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 121

SDS


Catalog Number: (RC55-5)
Supplier: Ricca Chemical
Description: 0.4359 Molar sodium acetate buffer adjusted with acetic acid to pH 4.5

Supplier: Ward's Science
Description: CAS Number: 631-61-8
Formula Weight: 77.09
Formula: CH3COONH4
Hazard Info: Irritant
Density (g/mL): 1.07
Boiling Point (°C): Decomposes
Freezing Point (°C): 114
Solubility: Water and Alcohol
Synonyms: Acetic Acid Ammonium Salt
Shelf Life (months): 12
Storage: Green

SDS

Supplier: Ward's Science
Description: CAS Number: 5743-26-0
Formula Weight: 176.18
Formula: Ca(CH3CO2)2·H2O
Density (g/mL): 0.3
Boiling Point (°C): Decomposes
Synonyms: Lime Acetate, Calcium Diacetate
Shelf Life (months): 12
Storage: Green

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
897 - 912 of 2,891
no targeter for Bottom