You Searched For: Gly-Arg-AMC


2,414  results were found

SearchResultCount:"2414"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76703-694)
Supplier: AFG Bioscience
Description: Human Platelet Glycoprotein Ib beta chain(GP1BB) ELISA Kit


Supplier: Thermo Scientific Chemicals
Description: Buffer with a useful pH range 7.5 to 8.9
Catalog Number: (89328-848)
Supplier: Genetex
Description: Rabbit polyclonal antibody to CLIP170


Catalog Number: (77440-346)
Supplier: Bioss
Description: Forms hydroxylysine residues in -Xaa-Lys-Gly- sequences in collagens. These hydroxylysines serve as sites of attachment for carbohydrate units and are essential for the stability of the intermolecular collagen cross-links.


Supplier: Bachem Americas
Description: The p-nitrophenylalanine-containing substrate PTEF-Nph-RL has been developed for a convenient assay of pepsin and other aspartic proteinases of animal and microbial origin. It is soluble over a wide pH range, with the Km values showing only little variation (Km = 80 µM at pH 3.1 and 37°C for porcine pepsin).

Catalog Number: (TCG0135-001G)
Supplier: TCI America
Description: CAS Number: 721-66-4
MDL Number: MFCD00065109
Molecular Formula: C11H14N2O3
Molecular Weight: 222.24
Form: Crystal
Color: White

SDS


Catalog Number: (103007-602)
Supplier: Anaspec Inc
Description: Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the English mutation, with His at position 6 replaced with Arg, was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRRDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4348.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (10487-042)
Supplier: Bioss
Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.


Catalog Number: (10487-030)
Supplier: Bioss
Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.


Catalog Number: (10459-276)
Supplier: Bioss
Description: Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10.


Catalog Number: (10459-268)
Supplier: Bioss
Description: Arginine methyltransferase that can both catalyze the formation of omega-N monomethylarginine (MMA) and symmetrical dimethylarginine (sDMA), with a preference for the formation of MMA. Specifically mediates the symmetrical dimethylation of arginine residues in the small nuclear ribonucleoproteins Sm D1 (SNRPD1) and Sm D3 (SNRPD3); such methylation being required for the assembly and biogenesis of snRNP core particles. Methylates SUPT5H. Mono- and dimethylates arginine residues of myelin basic protein (MBP) in vitro. Plays a role in the assembly of snRNP core particles. May play a role in cytokine-activated transduction pathways. Negatively regulates cyclin E1 promoter activity and cellular proliferation. May regulate the SUPT5H transcriptional elongation properties. May be part of a pathway that is connected to a chloride current, possibly through cytoskeletal rearrangement. Methylates histone H2A and H4 'Arg-3' during germ cell development. Methylates histone H3 'Arg-8', which may repress transcription. Methylates the Piwi proteins (PIWIL1, PIWIL2 and PIWIL4), methylation of Piwi proteins being required for the interaction with Tudor domain-containing proteins and subsequent localization to the meiotic nuage. Methylates RPS10.


Catalog Number: (AAH62914-03)
Supplier: Thermo Scientific Chemicals
Description: N-Boc-2-cyclopropyl-L-glycine, 95%

Supplier: TCI America
Description: CAS Number: 627-01-0
MDL Number: MFCD00037794
Molecular Formula: C4H9NO2
Molecular Weight: 103.12
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 190
Catalog Number: (10487-104)
Supplier: Bioss
Description: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. This unit is responsible of the peptidyl glutamyl-like activity. May catalyze basal processing of intracellular antigens.


Supplier: TCI America
Description: CAS Number: 111652-20-1
MDL Number: MFCD00191866
Molecular Formula: C11H21NO4
Molecular Weight: 231.29
Purity/Analysis Method: >98.0% (HPLC,N)
Form: Crystal
Melting point (°C): 67
Supplier: Bachem Americas
Description: MRFA is used as a calibration standard in mass spectrometry (ESI). Miao et al. studied Pt(II) complexes of the tetrapeptide by mass spectrometric methods. MRFA has been shown to be a competitive inhibitor of an enkephalin-generating endopeptidase isolated from rat brain. The peptide is a substrate for dipeptidyl peptidase III from human erythrocytes and for snapalysin.

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
1,153 - 1,168 of 2,414
no targeter for Bottom