You Searched For: MMP+inhibitor+I


11,418  results were found

SearchResultCount:"11418"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Bachem Americas
Description: The bioactive tetrapeptide goralatide which corresponds to the N-terminus of Thymosin β₄, is a physiological regulator of hematopoiesis and inhibits the entry into the S-phase of murine and human hematopoietic stem cells. Ac-SDKP has been shown to reduce the damage to specific compartments in the bone marrow resulting from treatment with chemotherapeutic agents, ionizing radiations, hyperthermy, or phototherapy. It protects from doxorubicin-induced toxicity. Ac-SDKP is a physiological substrate of angiotensin I- converting enzyme (ACE).

Catalog Number: (TCB1635-5G)
Supplier: TCI America
Description: CAS Number: 13726-69-7
MDL Number: MFCD00053370
Molecular Formula: C10H17NO5
Molecular Weight: 231.25
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 122
Specific rotation [a]20/D: -68 deg (C=1, MeOH)

Supplier: TCI America
Description: CAS Number: 84358-12-3
MDL Number: MFCD00673775
Molecular Formula: C11H19NO4
Molecular Weight: 229.28
Purity/Analysis Method: >97.0% (GC,T)
Form: Crystal
Melting point (°C): 160
Catalog Number: (103006-512)
Supplier: Anaspec Inc
Description: This is amino acid residue 139 to 151 of myelin proteolipid protein (PLP). This peptide is used to induce relapsing-remitting (RR)-EAE model.
Sequence: HCLGKWLGHPDKF
MW: 1537.8 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Catalog Number: (103006-334)
Supplier: Anaspec Inc
Description: This peptide corresponds to human, bovine (119-126), mouse, rat (118-125) and Heparin-Binding Growth Factor 2 (118-125) residues of bFGF. It inhibits dimerization and activation of bFGF receptors.
Sequence:KRTGQYKL
MW:993.2 Da
% peak area by HPLC:95
Storage condition:-20° C


Catalog Number: (103003-356)
Supplier: Anaspec Inc
Description: ACTH (1–17), and aMSH (a-Melanotropin), both derived from POMC (proopiomelanocortin) are involved in melanogenesis. However, ACTH (1-17) has been found to be more potent in malanogenesis in human malanocytes. Both ACTH (1-17) and aMSH also increase dendricity, and proliferation in follicular melanocytes.
Sequence: SYSMEHFRWGKPVGKKR
MW: 2093.4 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C


Supplier: Bachem Americas
Description: See also E-2410, Suc-Pro-OH, the product familiy 'Antihypertensive Peptides' and the subfamily 'Bradykinin-Potentiating Peptides (BPP)'.

Catalog Number: (103005-824)
Supplier: Anaspec Inc
Description: This is the most characterized fragment of the HIV transactivator protein (TAT). This arginine-rich TAT peptide penetrates plasma membrane directly, but not through endocytosis.
Sequence: YGRKKRRQRRR
MW: 1559.9 Da
% Peak area by HPLC: 95
Storage condition: -20°C


Supplier: Thermo Scientific Chemicals
Description: N-Boc-L-phenylalanyl-L-phenylalanine, 95%
Catalog Number: (A-1165.0250BA)
Supplier: Bachem Americas
Description: Partially protected Ala-D-IsoGln and Ala-IsoGln dipeptides.


Supplier: TCI America
Description: CAS Number: 84348-37-8
MDL Number: MFCD01860669
Molecular Formula: C10H15NO5
Molecular Weight: 229.23
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Melting point (°C): 158
Specific rotation [a]20/D: 20 deg (C=0.5, Acetone)
Storage Temperature: 0-10°C

SDS

Supplier: TCI America
Description: CAS Number: 114873-01-7
MDL Number: MFCD00672522
Molecular Formula: C14H18FNO4
Molecular Weight: 283.30
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 82
Specific rotation [a]20/D: 7 deg (C=1, MeOH)

SDS

Catalog Number: (TCB4083-5G)
Supplier: TCI America
Description: CAS Number: 53100-44-0
MDL Number: MFCD00672316
Molecular Formula: C10H15NO5
Molecular Weight: 229.23
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Melting point (°C): 119
Specific rotation [a]20/D: -34 deg (C=1, CHCl3)
Storage Temperature: 0-10°C

SDS


Catalog Number: (TCB2293-200MG)
Supplier: TCI America
Description: CAS Number: 192124-66-6
MDL Number: MFCD06797057
Molecular Formula: C15H28N2O6
Molecular Weight: 332.40
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal

SDS


Supplier: Anaspec Inc
Description: GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide) is a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP, together with GLP (Gastric-like Peptide) are members of the hormone peptide family of Incretins which stimulate insulin secretion from pancreatic islet β-cells, and also appears to promote beta cell proliferation and beta cell survival. Recent studies suggest that GIP plays a role in lipid homeostasis and possibly in the pathogenesis of obesity.
Sequence: YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKNDWKHNLTQ
MW: 5002.95 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier: TCI America
Description: CAS Number: 35897-34-8
MDL Number: MFCD00063594
Molecular Formula: C11H22N4O4
Molecular Weight: 310.78
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Specific rotation [a]20/D: -8 deg (C=2, H2O)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
17 - 32 of 11,418
no targeter for Bottom