You Searched For: Boc-Glu-NH\u2082


4,764  results were found

SearchResultCount:"4764"

Sort Results

List View Easy View

Rate These Search Results

Supplier: Thermo Scientific Chemicals
Description: Butylamine 99%
Catalog Number: (103010-794)
Supplier: Anaspec Inc
Description: 6-HEX, SE is a popular amino-reactive fluorescent probe that is widely used in nucleic acid sequencing and related research.


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00008236 Beilstein Registry No.: 505953
Catalog Number: (CAJT7440-01)
Supplier: AVANTOR PERFORMANCE MATERIAL LLC
Description: BAKERBOND®, 40 µm, 60 Å

Catalog Number: (CAPIPA5-18164)
Supplier: Thermo Scientific
Description: DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp and a protein kinase C-activating compound, mezerein . Irreversible reprogramming of melanomas can be achieved by treatment with both these agents; treatment with either agent alone only achieves reversible differentiation.


Catalog Number: (CA1.09900.0001)
Supplier: MilliporeSigma
Description: Cs50

Catalog Number: (CA80051-240)
Supplier: MilliporeSigma
Description: A cell-permeable inhibitor of caspase-3, as well as caspase-6, caspase-7, caspase-8, and caspase-10

Catalog Number: (10416-780)
Supplier: Bioss
Description: phosphorylated at the Thr-Pro-Tyr phosphorylation motif instead of the characteristic MAP kinase Thr-Glu-Tyr motif. JNK2 (p54a, SAPK1a), along with JNK1 and JNK3, is thought to play an important role in nuclear signal transduction through its environmental stress activation and subsequent phosphorylation of the nuclear transcription factor p53.


Catalog Number: (10485-270)
Supplier: Bioss
Description: Component of some SCF (SKP1-cullin-F-box) protein ligase complex that plays a central role in iron homeostasis by promoting the ubiquitination and subsequent degradation of IREB2/IRP2. Upon high iron and oxygen level, it specifically recognizes and binds IREB2/IRP2, promoting its ubiquitination and degradation by the proteasome. Promotes ubiquitination and subsequent degradation of DCTN1/p150-glued.


Catalog Number: (RCRV010131-50N)
Supplier: Ricca Chemical
Description: Ammonium dihydrogen phosphate 100,000 ppm in nitric acid 1%, VeriSpec™ matrix modifier solution, for atomic absorption spectroscopy

SDS


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00008205 Beilstein Registry No.: 1098243 Notes: Miscible with water, alcohol, ether
Supplier: Thermo Scientific Chemicals
Description: One unit makes one liter of 0.1N solution after dilution
Catalog Number: (103006-544)
Supplier: Anaspec Inc
Description: Several mutations within the β-amyloid precursor gene cause early onset familial Alzheimer's disease, and were shown to promote Aβ aggregation. In the arctic mutant, Glu 22 is replaced with Gly, resulting primarily in increased formation of Aβ protofibrils.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVV
Molecular Weight: 4257.8 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C


Catalog Number: (CAAAJ62046-AE)
Supplier: Thermo Scientific Chemicals
Description: Liquid

Catalog Number: (103007-682)
Supplier: Anaspec Inc
Description: This rat C-peptide-2 differs from the active human C-peptide by several amino acids, however conserved Glu at positions 3, 11, and 27 is essential for peptide activity. In rat medullary thick ascending limb, C-peptide stimulates Na+,K+-ATPase activity within a physiological concentration range. This effect is due to an increase in Na+,K+-ATPase turnover rate that is most likely mediated by protein kinase C-f phosphorylation of the Na+,K+-ATPase f-subunit.
Sequence: EVEDPQVAQLELGGGPGAGDLQTLALEVARQ
MW: 3161.5 Da
% Peak area by HPLC: 95
Storage condition: -20° C


Supplier: Thermo Scientific Chemicals
Description: MDL: MFCD00010890 Beilstein Registry No.: 3627235
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
977 - 992 of 4,764
no targeter for Bottom