Print…

You Searched For: Methyl-2-acetamidoacrylate


3,326  results were found

Refine Results Sort by
SearchResultCount:"3326"

Sort Results

List View Easy View

Rate These Search Results

Product Image-470225-820

Acetic Acid

Supplier: Ward's Science
Description: CAS Number: 64-19-7
Formula: CH3COOH
Density: 1.049 g/ml
Boiling Point: 118.1°C
Freezing Point: 16.7°C

SDS

Image Unavailable-76236-398

Tris-Acetate-EDTA (TAE) 50X, Rockland Immunochemicals

Catalog Number: (76236-398)
Supplier: Rockland Immunochemical
Description: Tris-Acetate-EDTA (TAE) is a buffer solution containing a mixture of Tris base, acetic acid and EDTA.
Product Image-CA45001-124

Corning® 3M™ Sodium Acetate, Corning

Catalog Number: (CA45001-124)
Supplier: Corning
Description: Sodium Acetate is a common molecular biology reagent. All production lots are tested to ensure that they are free of RNAse. It is often used in buffer systems to maintain the pH of a given solution.

Certificates


Image Unavailable-75834-908

Labeled Pesticide Residue Internal Standards for Food Analysis, Restek

Catalog Number: (75834-908)
Supplier: Restek
Description: Organic Standard, Diazinon-d10 (diethyl-d10)

Certificates


Product Image-97062-834

VWR® Sodium Acetate, 3M Solution, pH 5.2, Biotechnology Grade

Catalog Number: (97062-834)
Supplier: VWR
Description: Cloning Buffer, Sodium acetate solution 3M, pH 5.2

SDS Certificates


Image Unavailable-TCB3642-5G

tert-Butyl (4R,6R)-6-cyanomethyl-2,2-dimethyl-1,3-dioxane-4-acetate ≥98.0% (by GC, total nitrogen)

Catalog Number: (TCB3642-5G)
Supplier: TCI America
Description: CAS Number: 125971-94-0
MDL Number: MFCD03093958
Molecular Formula: C14H23NO4
Molecular Weight: 269.34
Purity/Analysis Method: >98.0% (GC,N)
Form: Crystal
Melting point (°C): 69
Specific rotation [a]20/D: -10 deg (C=1, CHCl3)

SDS


Product Image-66064-834

Target2™ Syringe Filters, Cellulose Acetate

Supplier: Thermo Scientific
Description: Cellulose acetate membrane for biological or protein-based samples.

Product Image-470301-040

Ethyl Acetate

Supplier: Ward's Science
Description: CAS Number: 141-78-6
Formula Weight: 88.11
Formula: CH3COOC2H5
Hazard Info: Flammable, Explosive, Irritant
Density (g/mL): 0.902
Boiling Point (°C): 77
Freezing Point (°C): -83.6
Solubility: Common Organic Solvents and Slightly in Water
Synonyms: Ethyl Acetic Ester
Shelf Life (months): 36
Storage: Red

SDS

Image Unavailable-TCD4968-25G

(Diethoxyphosphoryl)methyl-4-methylbenzenesulfonate ≥97.0% (by GC)

Catalog Number: (TCD4968-25G)
Supplier: TCI America
Description: Diethyl (p-Toluenesulfonyloxymethyl)phosphonate, Purity: >97%(GC), CAS: 31618-90-3, MF: C12H19O6PS, Synonym: (p-Toluenesulfonyloxymethyl)phosphonic Acid Diethyl Ester, (Diethoxyphosphoryl)methyl pToluenesulfonate, Form: Crystal-Powde, Size: 25G

SDS Certificates


Image Unavailable-100496-440

Collodion 2% in amyl acetate, non-filter

Supplier: Electron Microscopy Sciences
Description: Highly purified nitrocellulose (parlodion strip) in glass distilled amyl acetate. Useful for forming a negative replica to very fine detail.
Two types are available in range Electron Microscopy Sciences: Sterile formula which is filtered down to 0.45 micron and our non-sterile formula.
We are now offering Collodion (Parlodian) in a 30 ml bottle to avoid its classification as a hazardous chemical for shipping purposes.

Minority or Woman-Owned Business Enterprise

Product Image-470302-042

Potassium Acetate

Catalog Number: (470302-042)
Supplier: Ward's Science
Description: CAS Number: 127-08-2
Formula Weight: 98.14
Formula: CH3COOK
Density (g/mL): 1.57-1.8
Freezing Point (°C): 292
Solubility: Water
Synonyms: Acetic Acid Potassium Salt
Shelf Life (months): 36
Storage: Green

SDS


Product Image-470302-368

Silver Acetate

Catalog Number: (470302-368)
Supplier: Ward's Science
Description: CAS Number: 563-63-3
Formula: CH3COOAg
Density: 3.259 g/mL
Solubility: Hot Water and Nitric Acid
Synonyms: Argentous Acetate
Shelf Life: 36 Months

SDS


Product Image-CA470300-052

Acetic Anhydride

Catalog Number: (CA470300-052)
Supplier: ALDON CORP SE CA
Description: CAS Number: 108-24-7
Formula Weight: 102.09
Formula: C4H6O3
Hazard Info: Irritant, Corrosive, Flammable
Density (g/mL): 1.08
Boiling Point (°C): 139.9
Freezing Point (°C): -73
Solubility: Reacts with Water and Alcohol
Synonyms: Acetic Oxide, Acetyl Oxide, Ethanoic Anhydride, Acetic Acid Anhydride
Shelf Life (months): 36
Storage: White
Image Unavailable-103008-246

Human Amylin Acetate

Catalog Number: (103008-246)
Supplier: Anaspec Inc
Description: Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Image Unavailable-TCA1535-001G

Acetic acid (1S,2R)-2-[N-Benzyl-N-(mesitylenesulfonyl)amino]-1-phenylpropyl ester ≥98.0% (by HPLC)

Catalog Number: (TCA1535-001G)
Supplier: TCI America
Description: [Reagent for double aldol reaction]
CAS Number: 240423-53-4
MDL Number: MFCD02093425
Molecular Formula: C27H31NO4S
Molecular Weight: 465.61
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Melting point (°C): 121

SDS


Image Unavailable-TCD4756-5G

L-Aspartic aciddiethyl ester hydrochloride ≥98.0% (by HPLC, titration analysis)

Supplier: TCI America
Description: Diethyl L-Aspartate Hydrochloride, Purity: >98.0%(HPLC)(T), CAS Number: 16115-68-7, MF: C8H15NO4.HCl, MW: 225.67, Synonym: L-Aspartic Acid Diethyl Ester Hydrochloride, H-Asp(OEt)-OEt.HCl, Form: Crystal-Powder, Solid, Color: White - Almost white, Size: 25G

SDS

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
641 - 656 of 3,326
no targeter for Bottom