You Searched For: ADDISON+ELECTRIC+INC


34,929  results were found

SearchResultCount:"34929"

Sort Results

List View Easy View

Rate These Search Results

Catalog Number: (76528-072)
Supplier: VWR International
Description: Instantly cool electrical components to –65 °F.

SDS


Supplier: VWR International
Description: Activities are designed to guide students to discover concepts but are styled so the instructor knows what equipment is needed for each activity.

Catalog Number: (10014-824)
Supplier: VWR International
Description: VWR® polycarbonate resin is an amorphous engineering thermoplastic, characterized by outstanding mechanical, optical, electrical, and thermal properties.


Supplier: JML SCIENCES INC CA
Description: JULABO recirculating coolers can handle virtually any cooling requirements in laboratories or industrial environments.

Environmentally Preferable Irregular Voltage

Supplier: SCAT AMERICAS, INC.
Description: The SCAT Safety Waste Caps provide maximum safety for your HPLC liquid disposal. Safely dispose of your liquid laboratory waste without contaminating the ambient air by using SafetyWasteCaps with integrated exhaust air filters. These high-performance filters regulate the air pressure balance and prevent the escape of vapors due to the resulting overpressure in the disposal container. The variety of closures, connections and thread sizes allows optimal adaptation to your HPLC situation. Additional versions with grounding connections, level controls or safety funnels or offer every convenience for safe disposal.

Supplier: SCAT AMERICAS, INC.
Description: The strong and electrically conductive safety funnel 'ARNOLD' V2.0 with lid and ball meets the highest requirements for safe disposal of hazardous liquid waste due to its combination of two independent safety mechanisms. The two safety features consist of a ball integrated in the funnel basin and a sealing ring incorporated in the hinged lid of the funnel, which prevent the escape of toxic gases. The funnel is especially designed for explosive or flammable substances, as the PE-HD material used is eclectically conductive and charges can be dissipated via the ground cable.

Supplier: JML SCIENCES INC CA
Description: DYNEO™ DD heating circulator combinations with stainless steel bath tanks for internal or external temperature applications from 20 to 200 °C.

Irregular Voltage

Supplier: VWR International
Description: The VWR® antistatic ionizer aids in neturalizing electric charges in the air and on samples.

Supplier: VWR International
Description: Column extensions are used to extend Atlas uprights to or through ceilings to provide a chase for electric, data, or gas service lines.

Catalog Number: (470006-532)
Supplier: Avantor
Description: Introduce the concept of a simple electric circuit and show that a wire can carry electricity and how a switch can start and stop the current flow.


Supplier: Atago
Description: Model PAL-RI is designed for measuring Refractive Index, the measurement will be displayed continuously like an electric newsboard once the sample has been placed

Catalog Number: (30180-032)
Supplier: VWR International
Description: VWR® polycarbonate resin is an amorphous engineering thermoplastic, characterized by outstanding mechanical, optical, electrical, and thermal properties.

Catalog Number: (470136-062)
Supplier: Elenco Electronics
Description: Snap Circuits® makes learning electronics easy and fun! Just follow the colorful pictures in our manual and build exciting projects such as AM radios; burglar alarms; doorbells and much more! You can even play electronic games with your friends. All parts are mounted on plastic modules and snap together with ease. Enjoy hours of educational fun while learning about electronics. No tools required. Includes Projects 1-305 manuals (includes all of the SC100 projects and 200 new ones!).


Supplier: Anaspec Inc
Description: Pancreatic Polypeptide (PP) is a 36-amino acid anorexigenic peptide hormone secreted by the PP cells of pancreas as a response to hypoglycemia. It is rapidly released postprandially and continues to remain elevated for approximately 4-6 hours after a meal. PP modulates food intake, and is absent in children with Prader-Willi syndrome. Secretion of PP can be accomplished through electrical stimulation of the vagus nerve. Cholecystokinin (CCK) and Gastrin appear to be involved in its secretion, while Ghrelin, Obestatin and Somatostatin are reported to inhibit its release. PP is related to Peptide YY and Neuropeptide Y (NPY).
Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2
MW: 4181.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Catalog Number: (89071-908)
Supplier: VWR International
Description: This premium anti-static bag seals out both dust and moisture while controlling static electricity.


Supplier: Avantor
Description: Every color of the rainbow available!

Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
You must log in to order restricted items. We request that you provide the required business documentation to purchase this product for the first time.

To order chemicals, medical devices, or other restricted products please provide identification that includes your business name and shipping address via email CMD_NA@vwr.com or fax 484.881.5997 referencing your VWR account number . Acceptable forms of identification are:

  • issued document with your organization's Federal Tax ID Number
  • Government issued document with your organization's Resale Tax ID Number
  • Any other Government ID that includes the business name and address


VWR will not lift restrictions for residential shipping addresses.

-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is currently unavailable but limited stock may be available in our extended warehouse network. Please call 1-800-932-5000 and a VWR Customer Service Representative will help you.
113 - 128 of 34,929
no targeter for Bottom